Lus10026580 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 117 / 4e-33 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 115 / 2e-32 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
AT2G15170 66 / 1e-14 Plant basic secretory protein (BSP) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013863 171 / 4e-54 AT2G15220 224 / 9e-74 Plant basic secretory protein (BSP) family protein (.1)
Lus10026579 165 / 1e-51 AT2G15220 226 / 1e-74 Plant basic secretory protein (BSP) family protein (.1)
Lus10019806 117 / 4e-33 AT2G15220 279 / 8e-96 Plant basic secretory protein (BSP) family protein (.1)
Lus10014111 112 / 4e-31 AT2G15220 202 / 3e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10019799 111 / 1e-30 AT2G15220 199 / 2e-64 Plant basic secretory protein (BSP) family protein (.1)
Lus10019807 109 / 4e-30 AT2G15220 229 / 5e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10014106 107 / 4e-29 AT2G15220 230 / 2e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10026578 105 / 2e-28 AT2G15220 209 / 7e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026582 103 / 2e-27 AT2G15220 206 / 1e-66 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 124 / 4e-36 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 122 / 4e-35 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 120 / 1e-34 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 118 / 2e-33 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 114 / 3e-32 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10026580 pacid=23164242 polypeptide=Lus10026580 locus=Lus10026580.g ID=Lus10026580.BGIv1.0 annot-version=v1.0
ATGTCTCCCAAATTCCAGTTCCTCGTCATCCTAATCATGGCCACGTTAGCCACCGCGTCATCCGTAGACTTCCAGGTCATCAACAACTCCCCAACCACAA
AAGGAGGGGCCCGCTTCACATCCGAAATCGGAGCCAACTACACGAGGGACAAAATGTCAGAGTCCTCGGAGTTCATATGGCGGGAGATCTTCCACCAGCG
CACCCCTTCCGACCGGCGGAACTACCAACAAGTCAAGCTGTTCGTCAACACGTTCAACGCCACCAAAGTAGCCTACACGGGCGGCGGCAACGAGATCTAC
TTCAGCGCAGGGTACCTGGAGAAGTACAGCGGCGGCGCGTTGAGGCAGGAGTTCACGGGGATAATGTACAGGGAGATGGCGCGCGTGTGGCAGTGGACGG
GTGGCGGGTCGGGGCAGGCTAACGTCGGGTTGTTCGACGGGATCGCCAACTACGTGAGGATGAAGGCGGACCTTGTTGCGGAGAGCGGCTGA
AA sequence
>Lus10026580 pacid=23164242 polypeptide=Lus10026580 locus=Lus10026580.g ID=Lus10026580.BGIv1.0 annot-version=v1.0
MSPKFQFLVILIMATLATASSVDFQVINNSPTTKGGARFTSEIGANYTRDKMSESSEFIWREIFHQRTPSDRRNYQQVKLFVNTFNATKVAYTGGGNEIY
FSAGYLEKYSGGALRQEFTGIMYREMARVWQWTGGGSGQANVGLFDGIANYVRMKADLVAESG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10026580 0 1
AT4G27610 unknown protein Lus10043458 5.3 0.8765
AT1G65230 Uncharacterized conserved prot... Lus10027002 6.4 0.8915
Lus10008379 7.0 0.8720
AT2G45080 CYCP3;1 cyclin p3;1 (.1) Lus10028174 10.8 0.8600
AT3G19910 RING/U-box superfamily protein... Lus10029693 14.8 0.8790
AT3G61920 unknown protein Lus10030204 18.7 0.8396
Lus10025868 19.2 0.8780
AT3G53810 Concanavalin A-like lectin pro... Lus10016507 21.4 0.8417
Lus10038232 24.4 0.8757
AT2G36650 unknown protein Lus10023883 25.3 0.8756

Lus10026580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.