Lus10026583 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15130 127 / 4e-39 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
AT2G15220 129 / 1e-38 Plant basic secretory protein (BSP) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001360 183 / 8e-60 AT2G15220 202 / 3e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10001609 183 / 1e-59 AT2G15220 198 / 1e-63 Plant basic secretory protein (BSP) family protein (.1)
Lus10013869 147 / 2e-45 AT2G15220 209 / 5e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10026584 146 / 3e-45 AT2G15220 201 / 6e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10001608 145 / 3e-45 AT2G15220 182 / 2e-58 Plant basic secretory protein (BSP) family protein (.1)
Lus10026586 146 / 4e-45 AT2G15220 204 / 8e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10001359 146 / 5e-45 AT2G15220 204 / 7e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10001358 143 / 4e-44 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Lus10013867 142 / 1e-43 AT2G15220 201 / 1e-64 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 143 / 3e-44 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 140 / 3e-43 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 140 / 4e-43 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 135 / 6e-41 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 122 / 5e-36 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 51 / 1e-08 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10026583 pacid=23164228 polypeptide=Lus10026583 locus=Lus10026583.g ID=Lus10026583.BGIv1.0 annot-version=v1.0
ATGGAAATGGCGGCGGTTTGGCAGTGGAGCGGGAAAGGGGAAGCGCCCAAGGGGTTGTTGAGTGGGATCGCTGATTTCGTTAGGATGGCGGCGCATTACG
GGAACAGCCAGAAGGTGAGGCTTGGGGACGGGAGCCGGTGGGACCAGGGGGATGGTGTGACGGCAAGGTTTTTGGAGTTTTGTGAGAAGAAGAAGAAAGG
GTTCGTTAAGGATTTGAATAAGAAGATGAGGTATGGGTATACCAATGCTTACTTCGTTGACTTCTTGGGGAAGACGGTTGACCAGCTTTGGAAAGACTAC
AAGGCTAAGTATGCCAGGAAGTATTAA
AA sequence
>Lus10026583 pacid=23164228 polypeptide=Lus10026583 locus=Lus10026583.g ID=Lus10026583.BGIv1.0 annot-version=v1.0
MEMAAVWQWSGKGEAPKGLLSGIADFVRMAAHYGNSQKVRLGDGSRWDQGDGVTARFLEFCEKKKKGFVKDLNKKMRYGYTNAYFVDFLGKTVDQLWKDY
KAKYARKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15130 Plant basic secretory protein ... Lus10026583 0 1
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10041128 1.0 0.9403
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 5.3 0.8717
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 6.5 0.8717
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 7.5 0.8717
AT5G20260 Exostosin family protein (.1) Lus10039980 8.4 0.8717
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10013919 9.5 0.8562
AT1G18010 Major facilitator superfamily ... Lus10009413 10.2 0.8456
AT1G26730 EXS (ERD1/XPR1/SYG1) family pr... Lus10004284 10.6 0.8423
AT3G14250 RING/U-box superfamily protein... Lus10022064 11.2 0.8314
Lus10007539 11.5 0.6967

Lus10026583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.