Lus10026584 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 198 / 1e-63 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 186 / 4e-59 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
AT2G15170 53 / 4e-09 Plant basic secretory protein (BSP) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013867 438 / 4e-158 AT2G15220 201 / 1e-64 Plant basic secretory protein (BSP) family protein (.1)
Lus10026585 345 / 2e-121 AT2G15220 207 / 2e-67 Plant basic secretory protein (BSP) family protein (.1)
Lus10013868 343 / 1e-120 AT2G15220 217 / 3e-71 Plant basic secretory protein (BSP) family protein (.1)
Lus10013869 306 / 9e-106 AT2G15220 209 / 5e-68 Plant basic secretory protein (BSP) family protein (.1)
Lus10001607 303 / 9e-105 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Lus10001359 303 / 2e-104 AT2G15220 204 / 7e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10001358 299 / 3e-103 AT2G15220 192 / 2e-61 Plant basic secretory protein (BSP) family protein (.1)
Lus10026586 298 / 1e-102 AT2G15220 204 / 8e-66 Plant basic secretory protein (BSP) family protein (.1)
Lus10001608 264 / 6e-90 AT2G15220 182 / 2e-58 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 216 / 1e-70 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 211 / 1e-68 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 208 / 1e-67 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 206 / 1e-66 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 199 / 3e-64 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 69 / 1e-13 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10026584 pacid=23164276 polypeptide=Lus10026584 locus=Lus10026584.g ID=Lus10026584.BGIv1.0 annot-version=v1.0
ATGTCTACCAACGCCGCCACCTTCCTAGCAACCTGCCTGGTCGTCGTCCTGACAGCAGCCGCCACCGTCCGCTCCGAGAGCCCCGTTCTCTACACGGTAA
CCAACGCCGCCAACAATACCCCAGGCGGGGCCCGCTTCGAATCCGAGATCGGGGCCAAATTCGCCATGCAGACCATGTACGCCGCCACTCGCTTCACGTG
GATCCTGTTCAACCAGACAGACGACGTCACCGCACGAAAGAACATAACCGAGATCAGCCTCTTCGTCGACAACGGCACGATCAGCGGCGGGAACAACAGT
AATAAAGAAGTCGCAGCGCAGACGAAGAACACCACGATCCACCTGAGCGCCGACTTCATTGGGAGCTACACCCGAAACCTGAGGAGGCAGTTCAACGGGG
TGATGTACCAGGAAGTCGCCGGGATCTGGCAGTGGGACGCGCGTGGTCAGGCGCCAGCGGGGCTGGTGAGTGGGATTGCGCATTTCGTGAGGCTGCAGGC
GCGTTACGGCACCGTGGAGACTGCGAAGCCAGGGGAAGGAGATCGGTGGGACCAAGGTAACGGCGTGACGGCGAGGTTTTTGGGGTACTGCGAGAAGCTG
AAGAAGGGGTTTGTCGGGGAGCTGAATAAGAAGATGAGGCATGGCTATACGGATGGTTTCTTCCTGGATTTGCTTGGGTTGACTGTTGACCATTTGTGGA
GTAATTACAAGGAGAAGTTCCACAACTGA
AA sequence
>Lus10026584 pacid=23164276 polypeptide=Lus10026584 locus=Lus10026584.g ID=Lus10026584.BGIv1.0 annot-version=v1.0
MSTNAATFLATCLVVVLTAAATVRSESPVLYTVTNAANNTPGGARFESEIGAKFAMQTMYAATRFTWILFNQTDDVTARKNITEISLFVDNGTISGGNNS
NKEVAAQTKNTTIHLSADFIGSYTRNLRRQFNGVMYQEVAGIWQWDARGQAPAGLVSGIAHFVRLQARYGTVETAKPGEGDRWDQGNGVTARFLGYCEKL
KKGFVGELNKKMRHGYTDGFFLDLLGLTVDHLWSNYKEKFHN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10026584 0 1
Lus10013963 7.0 0.8612
AT3G50845 Protein of unknown function (D... Lus10014311 11.2 0.8475
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029316 13.3 0.8437
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10006917 15.9 0.8434
AT1G25270 nodulin MtN21 /EamA-like trans... Lus10015066 20.1 0.8290
Lus10006918 21.6 0.8284
Lus10007508 23.4 0.8284
AT1G04670 unknown protein Lus10004041 25.0 0.8284
AT3G56960 PIP5K4 phosphatidyl inositol monophos... Lus10039011 26.1 0.6951
AT5G60010 ferric reductase-like transmem... Lus10019390 26.5 0.8284

Lus10026584 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.