Lus10026593 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013881 179 / 4e-58 ND 37 / 0.003
Lus10020975 97 / 5e-26 AT5G13920 42 / 5e-05 GRF zinc finger / Zinc knuckle protein (.1)
Lus10025368 95 / 4e-25 AT3G42860 44 / 1e-05 zinc knuckle (CCHC-type) family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026593 pacid=23164401 polypeptide=Lus10026593 locus=Lus10026593.g ID=Lus10026593.BGIv1.0 annot-version=v1.0
ATGACGACGATGAAGATGATCAGTCCGTACCAGAATGCTTCTGTGGCTTCCCCGCGAAACTACGCATGTCTCAAACCGCCAAGAATACACTCCGGTTTAT
TCTACAACTGTCAAGGTTTCGACGATTGCAACTTCTTCCAGTGGTGTGATGAGCCAACTCAAACAGGAGATAAGCATTTCGACGAGCTAACCCGCTATCG
TCACGAGTGCATTGCAATCCAGCAGAAGTACGAGAACCAAGTGCAGGAGCATGCGAACAAGAGGAGAAAATGGGCGACTGAAAAAGAGTTTCTTGTGTCT
GAACTAGACAAAGTTCGAGCAGAGCGGGATGAGCTCAAGAAGAGGGCTAAACTCGTGGGGGAGTCTGATCTTATGCCAGCAGTGGATCCGATGCCAAGCA
GTTCCAACGCCGGTAAGAGCGGCTGGCGGCGACGATATTTGCTATTGGAATCTCCGACGAAGTTGAATTGA
AA sequence
>Lus10026593 pacid=23164401 polypeptide=Lus10026593 locus=Lus10026593.g ID=Lus10026593.BGIv1.0 annot-version=v1.0
MTTMKMISPYQNASVASPRNYACLKPPRIHSGLFYNCQGFDDCNFFQWCDEPTQTGDKHFDELTRYRHECIAIQQKYENQVQEHANKRRKWATEKEFLVS
ELDKVRAERDELKKRAKLVGESDLMPAVDPMPSSSNAGKSGWRRRYLLLESPTKLN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026593 0 1
Lus10014857 3.6 1.0000
Lus10027374 3.7 1.0000
Lus10015823 6.6 1.0000
Lus10016593 6.7 1.0000
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10009470 10.2 1.0000
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10015880 13.6 1.0000
Lus10016867 13.7 1.0000
Lus10015929 17.0 1.0000
AT5G12180 CPK17 calcium-dependent protein kina... Lus10000889 18.3 1.0000
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10023221 19.3 1.0000

Lus10026593 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.