Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25580 169 / 3e-54 Thioredoxin superfamily protein (.1) AT2G18990 165 / 6e-53 TXND9 thioredoxin domain-containing protein 9 homolog (.1) AT5G66410 77 / 5e-18 PLP3B phosducin-like protein 3 homolog (.1) AT3G50960 74 / 4e-17 PLP3A phosducin-like protein 3 homolog (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013889 [exp] 220 / 3e-75 AT3G25580 255 / 1e-87 Thioredoxin superfamily protein (.1) Lus10025176 [exp] 84 / 1e-20 AT5G66410 362 / 1e-128 phosducin-like protein 3 homolog (.1) Lus10016055 [exp] 80 / 3e-19 AT5G66410 357 / 2e-126 phosducin-like protein 3 homolog (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G092700 [exp] 161 / 2e-51 AT2G18990 290 / 2e-100 thioredoxin domain-containing protein 9 homolog (.1) Potri.001G297900 [exp] 154 / 1e-48 AT3G25580 286 / 3e-99 Thioredoxin superfamily protein (.1) Potri.007G020400 [exp] 75 / 2e-17 AT5G66410 297 / 8e-103 phosducin-like protein 3 homolog (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026602 pacid=23164232 polypeptide=Lus10026602 locus=Lus10026602.g ID=Lus10026602.BGIv1.0 annot-version=v1.0 ATGTTCTCCATCGAGGAACTGGAAAACGTGGTGGACAAGCATCTTGCAATATTGGCAAAACAGCACATCGAGACTCGATTTGTGAAAATCAATGCCGAGA AAAGCCCCTTTTTGGCCGATAAACTCAAGATTGTGGTTCTTCCTACTCTTGCCCTCATTAAGAATGCCAAAGTCGATGACTACGTGGTTGGTTTTGATCA GCTTGGCGGGACTGATGATTTTAGCACCGAGGAATTAGAGGAGAGGCTGGCTAAAGCTAAAGTAATCTTCTACGAAGATGAATCATCTGTGGCAAGGTCA AGCAACCAGACTAAGAGGAACGTCAGACAAAGCGAAACTCACGACTCCTCAGATTCCGAATGA
AA sequence Show only first row Show all	>Lus10026602 pacid=23164232 polypeptide=Lus10026602 locus=Lus10026602.g ID=Lus10026602.BGIv1.0 annot-version=v1.0 MFSIEELENVVDKHLAILAKQHIETRFVKINAEKSPFLADKLKIVVLPTLALIKNAKVDDYVVGFDQLGGTDDFSTEELEERLAKAKVIFYEDESSVARS SNQTKRNVRQSETHDSSDSE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25580			Thioredoxin superfamily protei...		Lus10026602 [exp]	0	1
AT5G01650			Tautomerase/MIF superfamily pr...		Lus10022681 [exp]	4.7	0.8159
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10022499 [exp]	5.7	0.8167
AT1G09680			Pentatricopeptide repeat (PPR)...		Lus10014170 [exp]	6.6	0.8014
AT1G31790			Tetratricopeptide repeat (TPR)...		Lus10035697 [exp]	11.4	0.7562
AT5G54855			Pollen Ole e 1 allergen and ex...		Lus10003874 [exp]	12.0	0.7283
AT2G43770			Transducin/WD40 repeat-like su...		Lus10002211 [exp]	13.4	0.7673
AT2G41475			Embryo-specific protein 3, (AT...		Lus10043273 [exp]	14.4	0.7480
AT1G09900			Pentatricopeptide repeat (PPR-...		Lus10037013 [exp]	14.8	0.8078
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10001008 [exp]	15.9	0.7853
AT1G31830			Amino acid permease family pro...		Lus10007593 [exp]	16.5	0.7844

Compare expression of checked genes

Lus10026602 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.