Lus10026616 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47790 76 / 2e-15 F-box and associated interaction domains-containing protein (.1)
AT1G32420 69 / 3e-13 F-box and associated interaction domains-containing protein (.1)
AT4G38870 62 / 8e-11 F-box and associated interaction domains-containing protein (.1)
AT4G09190 62 / 1e-10 F-box and associated interaction domains-containing protein (.1)
AT1G47765 59 / 6e-10 F-box and associated interaction domains-containing protein (.1)
AT4G21240 59 / 1e-09 F-box and associated interaction domains-containing protein (.1)
AT1G47730 58 / 2e-09 F-box and associated interaction domains-containing protein (.1)
AT1G50870 57 / 5e-09 F-box and associated interaction domains-containing protein (.1)
AT3G10240 55 / 2e-08 F-box and associated interaction domains-containing protein (.1)
AT3G61340 54 / 4e-08 F-box and associated interaction domains-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007285 256 / 5e-83 AT3G04660 82 / 7e-17 F-box and associated interaction domains-containing protein (.1)
Lus10007277 256 / 6e-83 AT3G04660 82 / 6e-17 F-box and associated interaction domains-containing protein (.1)
Lus10011210 250 / 5e-80 AT1G32420 87 / 7e-19 F-box and associated interaction domains-containing protein (.1)
Lus10013934 214 / 1e-66 AT1G11270 72 / 7e-14 F-box and associated interaction domains-containing protein (.1.2.3)
Lus10011190 216 / 3e-66 AT1G32420 78 / 1e-15 F-box and associated interaction domains-containing protein (.1)
Lus10016866 206 / 7e-62 AT1G32420 84 / 2e-17 F-box and associated interaction domains-containing protein (.1)
Lus10011200 189 / 2e-58 AT1G47790 84 / 2e-18 F-box and associated interaction domains-containing protein (.1)
Lus10007606 183 / 2e-56 AT1G47790 67 / 3e-12 F-box and associated interaction domains-containing protein (.1)
Lus10011197 187 / 1e-55 AT1G47790 86 / 6e-18 F-box and associated interaction domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G458400 78 / 5e-16 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1)
Potri.001G318400 71 / 1e-13 AT3G06240 142 / 3e-38 F-box family protein (.1)
Potri.007G074084 64 / 2e-11 AT1G11270 83 / 1e-17 F-box and associated interaction domains-containing protein (.1.2.3)
Potri.019G062900 61 / 2e-10 AT1G50870 69 / 1e-12 F-box and associated interaction domains-containing protein (.1)
Potri.001G035500 61 / 2e-10 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.001G318300 57 / 3e-09 AT3G06240 140 / 7e-38 F-box family protein (.1)
Potri.011G037312 57 / 3e-09 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1)
Potri.017G058000 57 / 4e-09 AT3G06240 138 / 5e-37 F-box family protein (.1)
Potri.011G037200 55 / 2e-08 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1)
Potri.012G099733 53 / 8e-08 AT3G16210 92 / 2e-20 F-box family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0162 FBA PF08268 FBA_3 F-box associated domain
CL0271 F-box PF00646 F-box F-box domain
Representative CDS sequence
>Lus10026616 pacid=23164247 polypeptide=Lus10026616 locus=Lus10026616.g ID=Lus10026616.BGIv1.0 annot-version=v1.0
ATGGGTGGAAGAAGACGCCGGGAAAGTGAAGTTGGGTATGAGGAGAGGAGGAAGAAGAGGAAGCTGGAGGAGACGACGACCACAAATAACAAGGATTTTA
GTCTGATTTGGGCAACAAATAAGAATGATTTTCATGCCGATATGGTAGCTACGCAGATACTTAGTAGACTCCCAGCCAAGTCACTTATGCGGTTCAAGTC
AGCCTGTAGAGGCTGGCGATCGATGATCGAAAAAGATTCGCACTTTATCAATTTACACCGCATACGTTCACAAGCACGCCGCCCGCCCGATCTGGACTGT
GGTGATGATGGTGACCAGCTCAGAGGAGTAGCCACTGTTGAGAGCGTAACGAGAGTGGGAATCCCATGTCCTGCACATGTTGGAATTAGGGGACCTGTTA
GGGGATTGGTCTGTTTCTTTGACGTTCGCAACTTGGTTTTAACAGAACCGCCGGTATGTGAATTCGGATTCGACCCCGATTCGGGAGAGCATAAAGTTAT
TTTCGTGTGGCATGATTCTCCTGAAGCAGCAGCTTGTTGTGAGGTGTTGACTGTAGGGGTTGACTCTAGTTGGAGAATAACTGATGATGTACCTCCTAGA
TATGACTTCTCCGGGTATATGAGTGCTTATGCCAATGGTTCCATCTATTATATGTTCCACAACAAGGCTGGGGCTGGCATTGAAGTAGTTGATGATATGA
ATAATTACGATACTCTAGTGGCATTTGACATTGGATCTGAGAAGTTCAGGATGATAAAGATTCCCATATTCCGCTCCCCCAATTTGATGGAACTGGATGG
GTGTCTAACCATGGTGCTTAAGTGCATCAAAACAGCGCGAACGCAGAAGCTATGA
AA sequence
>Lus10026616 pacid=23164247 polypeptide=Lus10026616 locus=Lus10026616.g ID=Lus10026616.BGIv1.0 annot-version=v1.0
MGGRRRRESEVGYEERRKKRKLEETTTTNNKDFSLIWATNKNDFHADMVATQILSRLPAKSLMRFKSACRGWRSMIEKDSHFINLHRIRSQARRPPDLDC
GDDGDQLRGVATVESVTRVGIPCPAHVGIRGPVRGLVCFFDVRNLVLTEPPVCEFGFDPDSGEHKVIFVWHDSPEAAACCEVLTVGVDSSWRITDDVPPR
YDFSGYMSAYANGSIYYMFHNKAGAGIEVVDDMNNYDTLVAFDIGSEKFRMIKIPIFRSPNLMELDGCLTMVLKCIKTARTQKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47790 F-box and associated interacti... Lus10026616 0 1
AT1G67340 HCP-like superfamily protein w... Lus10011362 5.1 0.6867
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10041300 11.0 0.6553
AT5G45100 BRG1 BOI-related gene 1, SBP (S-rib... Lus10040613 11.0 0.6426
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Lus10037069 13.6 0.6528
AT5G53400 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones... Lus10040656 26.1 0.6371
AT5G23850 Arabidopsis thaliana protein o... Lus10037863 34.3 0.6209
AT1G44350 ILL6 IAA-leucine resistant (ILR)-li... Lus10018169 35.2 0.6398
AT4G08455 BTB/POZ domain-containing prot... Lus10042763 51.3 0.6171
AT4G05460 RNI-like superfamily protein (... Lus10026115 93.1 0.5181
AT5G25280 serine-rich protein-related (.... Lus10008808 133.0 0.5412

Lus10026616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.