Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14040 50 / 4e-09 EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03240 47 / 5e-08 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G35350 44 / 5e-07 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G26730 43 / 1e-06 EXS (ERD1/XPR1/SYG1) family protein (.1) AT4G25350 43 / 2e-06 SHB1 SHORT HYPOCOTYL UNDER BLUE1, EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03260 42 / 3e-06 EXS (ERD1/XPR1/SYG1) family protein (.1) AT1G69480 39 / 4e-05 EXS (ERD1/XPR1/SYG1) family protein (.1) AT2G03250 36 / 0.0004 EXS (ERD1/XPR1/SYG1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030440 [exp] 69 / 1e-15 AT1G14040 1048 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10030439 [exp] 66 / 2e-14 AT1G14040 1127 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10026623 [exp] 63 / 2e-13 AT1G14040 1058 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10030438 [exp] 56 / 7e-11 AT1G14040 976 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10031081 [exp] 52 / 7e-10 AT1G14040 191 / 9e-56 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10036779 [exp] 49 / 1e-08 AT1G14040 1080 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10037147 [exp] 47 / 7e-08 AT1G14040 1071 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10036781 [exp] 45 / 3e-07 AT1G14040 561 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Lus10036782 [exp] 45 / 3e-07 AT1G14040 322 / 4e-103 EXS (ERD1/XPR1/SYG1) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G090400 [exp] 55 / 8e-11 AT1G14040 1037 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G164900 [exp] 55 / 8e-11 AT1G14040 992 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165800 [exp] 52 / 8e-10 AT1G14040 1032 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.010G165300 [exp] 49 / 1e-08 AT1G14040 1022 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.016G032900 [exp] 47 / 4e-08 AT1G14040 865 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.008G090300 [exp] 42 / 3e-06 AT1G69480 831 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1) Potri.017G086800 [exp] 39 / 4e-05 AT3G29060 853 / 0.0 EXS (ERD1/XPR1/SYG1) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03105 [flax] [poplar] SPX SPX domain
Representative CDS sequence Show only first row Show all	>Lus10026622 pacid=23164399 polypeptide=Lus10026622 locus=Lus10026622.g ID=Lus10026622.BGIv1.0 annot-version=v1.0 ATGGTGCCGGAGTGGCAAGCAGCATACATGGATTACAACTTCCTCAAAACCCTCTTGAAAGAAATTCAAAAAGTCTGGCAAAGAACCAAGCCAACAACAT CGGTAGAGAAGTACAGAGCGTTCAAATCGGTACCGCTGCCTTTCAATTACGACGAAGATGATGACAAAGACGAGTAG
AA sequence Show only first row Show all	>Lus10026622 pacid=23164399 polypeptide=Lus10026622 locus=Lus10026622.g ID=Lus10026622.BGIv1.0 annot-version=v1.0 MVPEWQAAYMDYNFLKTLLKEIQKVWQRTKPTTSVEKYRAFKSVPLPFNYDEDDDKDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G03240			EXS (ERD1/XPR1/SYG1) family pr...		Lus10026622 [exp]	0	1
AT3G29034			unknown protein		Lus10033010 [exp]	5.4	0.8888
AT3G22800			Leucine-rich repeat (LRR) fami...		Lus10006611 [exp]	9.9	0.8614
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10008090 [exp]	17.5	0.8671
AT5G58750			NAD(P)-binding Rossmann-fold s...		Lus10040675 [exp]	23.5	0.8507
AT2G37710		RLK	receptor lectin kinase (.1)		Lus10035627 [exp]	26.2	0.7895
AT1G68400			leucine-rich repeat transmembr...		Lus10040653 [exp]	27.2	0.8537
AT4G23340			2-oxoglutarate (2OG) and Fe(II...		Lus10009663 [exp]	29.3	0.8452
AT3G22800			Leucine-rich repeat (LRR) fami...		Lus10039363 [exp]	31.4	0.8188
AT5G51500			Plant invertase/pectin methyle...		Lus10031140 [exp]	31.6	0.8451
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10027458 [exp]	32.2	0.8296

Compare expression of checked genes

Lus10026622 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.