Lus10026631 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26660 142 / 4e-44 Prefoldin chaperone subunit family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030428 263 / 5e-92 AT1G26660 157 / 4e-50 Prefoldin chaperone subunit family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G091400 223 / 3e-76 AT1G26660 169 / 1e-54 Prefoldin chaperone subunit family protein (.1.2)
Potri.010G163600 0 / 1 AT1G26660 0 / 1 Prefoldin chaperone subunit family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0200 Prefoldin PF02996 Prefoldin Prefoldin subunit
Representative CDS sequence
>Lus10026631 pacid=23164342 polypeptide=Lus10026631 locus=Lus10026631.g ID=Lus10026631.BGIv1.0 annot-version=v1.0
ATGGACAAGCAACGGCAAGATAAGATTCAGAAGTTCGAGGAATTCGTCGACGGCCGATTGAAGCCTGACCTTGTTAAGGCTATCGGTGAAAGGGATAAGA
TATTTGAACAGCAGAAGATATTCTCGGATTTGAAGAGAAACATTGAGAACTTGGAAAAGAACAGCGTTACGAGTCTTAGGACATTGGTGGACATTGGCTC
TCAAGTTTACATGCAAGCAGATGTGGCGGATGCACAGCGCATTTTTGTCGACTTTGGGCTCGGATTCCATGTCGAGTTCACTTGGTCAGAAGCTCTGAAC
TATATCTCGTTGCGGGAAGAGAAGATTGCCAGGCAAATAGGGGAGTATACTAGGCAGATCGCATCGATCAAGACACAGATCAAGACGGTCATTGAAGGCA
TTCGAGAGTTGCTAGAACTTCCAGCAGAGAAGCTTCCACCGCAACGGGTCTTCTAA
AA sequence
>Lus10026631 pacid=23164342 polypeptide=Lus10026631 locus=Lus10026631.g ID=Lus10026631.BGIv1.0 annot-version=v1.0
MDKQRQDKIQKFEEFVDGRLKPDLVKAIGERDKIFEQQKIFSDLKRNIENLEKNSVTSLRTLVDIGSQVYMQADVADAQRIFVDFGLGFHVEFTWSEALN
YISLREEKIARQIGEYTRQIASIKTQIKTVIEGIRELLELPAEKLPPQRVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26660 Prefoldin chaperone subunit fa... Lus10026631 0 1
AT5G46030 unknown protein Lus10025438 1.0 0.9215
AT1G25260 Ribosomal protein L10 family p... Lus10001072 1.4 0.9080
AT4G01590 unknown protein Lus10006847 3.7 0.8210
AT3G58130 N-acetylglucosaminylphosphatid... Lus10034805 3.9 0.8537
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Lus10036200 4.2 0.8735
AT1G60670 Protein of unknown function (D... Lus10013072 4.9 0.8581
AT5G64560 MRS2-2, ATMGT9 magnesium transporter 9 (.1.2) Lus10041169 5.3 0.8362
AT3G29000 Calcium-binding EF-hand family... Lus10019090 5.5 0.8395
Lus10008388 5.7 0.8266
AT5G12320 ankyrin repeat family protein ... Lus10036033 7.9 0.8030

Lus10026631 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.