Lus10026638 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69390 247 / 3e-83 ARC12, ATMINE1 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030421 427 / 4e-154 AT1G69390 248 / 9e-84 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10036802 310 / 5e-108 AT1G69390 253 / 3e-85 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Lus10037128 298 / 5e-103 AT1G69390 256 / 2e-86 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G162600 307 / 1e-106 AT1G69390 272 / 5e-93 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.008G092300 302 / 5e-105 AT1G69390 270 / 2e-92 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.004G121000 187 / 6e-60 AT1G69390 191 / 2e-61 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
Potri.017G088401 89 / 4e-23 AT1G69390 86 / 2e-22 accumulation and replication of chloroplasts 12, homologue of bacterial MinE 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03776 MinE Septum formation topological specificity factor MinE
Representative CDS sequence
>Lus10026638 pacid=23164340 polypeptide=Lus10026638 locus=Lus10026638.g ID=Lus10026638.BGIv1.0 annot-version=v1.0
ATGGCGATCTCCGGAGATCTGAGTGTCTCTGCAGCATTGGCATCCTACCCTAAGCACCAGCCTCTCAGAAGCTTGCCTCTTTCATCGACATCAAAGGTGG
ACTTCAACACATTCCCCAGCGGAAGATCAGCAACCACCATCACACTTTCGAACCGCAAACCAAATGCTCCCATTCAACGATCAGCCGGCATCTCCAAAGA
TTACGAGATGTCCTCAGCCACCACATTCAACCAAGACACTGAGGCTTTCCTCCTCAACGCCATAAACATGAGCCTCCTTGAGCGACTCACCTTAGCGTGG
AAGCTAATCTTCCCATCACCCGCCAGACAAAAGACTTCCAATGCAAGGATAGCCAAGCAGCGCCTCAAGATGATCCTCTTCTCCGATCGGTGTGCAGTCA
GCGACGAGGCCAAGAGGAAGATCGTGAACAACATCGTTCACGCCCTCTCCGAGTTCGTCGAGATCGAGTCCCAGGACAAAGTGCAGCTCAGTGTCACTAC
CGACACCGACTTGGGGACGATGTACTCGGTTACGGTTCCCGTTAGAAGAGTGAAGCCGGAGTACCTGGAAATCGAGGATGTTGGATCAATTACCAACATC
GAGTACAGAGAAACCGGACGGGATGGAGATGATTCGGTCGATGTTACTTTCGATTTCTACATTCCGGATGAAAGGACTCGGTGA
AA sequence
>Lus10026638 pacid=23164340 polypeptide=Lus10026638 locus=Lus10026638.g ID=Lus10026638.BGIv1.0 annot-version=v1.0
MAISGDLSVSAALASYPKHQPLRSLPLSSTSKVDFNTFPSGRSATTITLSNRKPNAPIQRSAGISKDYEMSSATTFNQDTEAFLLNAINMSLLERLTLAW
KLIFPSPARQKTSNARIAKQRLKMILFSDRCAVSDEAKRKIVNNIVHALSEFVEIESQDKVQLSVTTDTDLGTMYSVTVPVRRVKPEYLEIEDVGSITNI
EYRETGRDGDDSVDVTFDFYIPDERTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10026638 0 1
AT1G69390 ARC12, ATMINE1 accumulation and replication o... Lus10030421 1.4 0.8893
AT5G23140 NCLPP7, NCLPP2,... nuclear-encoded CLP protease P... Lus10013435 3.6 0.8967
AT1G76660 unknown protein Lus10025171 8.1 0.8642
AT4G13220 unknown protein Lus10011887 8.7 0.8889
AT5G38060 unknown protein Lus10004070 8.9 0.8571
AT2G23820 Metal-dependent phosphohydrola... Lus10015497 9.5 0.8608
AT3G03220 ATHEXPALPHA1.22... EXPANSIN 13, expansin A13 (.1) Lus10003822 10.2 0.8342
AT4G27620 unknown protein Lus10028872 11.0 0.8287
AT5G05830 RING/FYVE/PHD zinc finger supe... Lus10016451 15.1 0.8042
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10017605 16.0 0.8384

Lus10026638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.