Lus10026642 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69350 96 / 2e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G52850 69 / 4e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G66520 61 / 3e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G12770 59 / 1e-10 MEF22 mitochondrial editing factor 22 (.1)
AT4G35130 56 / 8e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G31920 55 / 2e-09 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G37570 54 / 5e-09 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G63370 54 / 5e-09 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G25270 54 / 5e-09 OTP70 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G03380 54 / 7e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014950 65 / 1e-12 AT5G52850 683 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10029436 64 / 2e-12 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10018492 62 / 6e-12 AT4G18750 385 / 2e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039703 62 / 7e-12 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10024876 60 / 7e-11 AT3G12770 886 / 0.0 mitochondrial editing factor 22 (.1)
Lus10031714 59 / 8e-11 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000706 59 / 9e-11 AT3G12770 878 / 0.0 mitochondrial editing factor 22 (.1)
Lus10002024 56 / 9e-10 AT5G56310 344 / 6e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10002552 55 / 3e-09 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G093000 118 / 2e-31 AT1G69350 832 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 64 / 2e-12 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G152000 62 / 1e-11 AT3G12770 931 / 0.0 mitochondrial editing factor 22 (.1)
Potri.006G105700 62 / 1e-11 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G178200 61 / 2e-11 AT4G35130 919 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G071800 57 / 3e-10 AT5G52850 803 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G135400 57 / 3e-10 AT1G31920 738 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G006800 57 / 5e-10 AT3G16610 687 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.002G220300 57 / 6e-10 AT1G11290 559 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G128900 57 / 6e-10 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026642 pacid=23164404 polypeptide=Lus10026642 locus=Lus10026642.g ID=Lus10026642.BGIv1.0 annot-version=v1.0
ATGAGCTCGCTGATCATAAACCTTCCCACGCAGCTCTTCGACGATGACGCTCTACATACCAATGTTCAGAGCAAGCACGACTCCATGGCTCATCACACAG
CTCCACGCCCATCTCTTCGTCACAGGCCTCCACCACGACCCGCAAGCTTCAACAAAGCTCATCGAGTCATATTCACAAACATCTTCCCTGCATTCCGCCG
CGCTCGCCTTCAAATCCCTTCTCCCGATTCCTTCATGTGGGGGGTGATCCTCAAGTGCCACGTCTGGTCACATCAGTATCAACCCGCCATTTCGCTCTAC
CACGACATGCTCTACTCCGGAACTCCCGTCGGTGGATTCGTGTTTCCTTCCGCTCTGAGGGCTTGTGCCGGATTTGGCGATGTGGGTGTTGGAATGAAGG
TTCACGGGAGTGTTACCAAGCTCGGGTTCGATTCCGATCCGGTTACCGAAACCTCGCTTTAA
AA sequence
>Lus10026642 pacid=23164404 polypeptide=Lus10026642 locus=Lus10026642.g ID=Lus10026642.BGIv1.0 annot-version=v1.0
MSSLIINLPTQLFDDDALHTNVQSKHDSMAHHTAPRPSLRHRPPPRPASFNKAHRVIFTNIFPAFRRARLQIPSPDSFMWGVILKCHVWSHQYQPAISLY
HDMLYSGTPVGGFVFPSALRACAGFGDVGVGMKVHGSVTKLGFDSDPVTETSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69350 Tetratricopeptide repeat (TPR)... Lus10026642 0 1
AT1G28270 RALFL4 ralf-like 4 (.1) Lus10025444 4.6 0.6595
Lus10012623 22.4 0.5960
Lus10032803 60.5 0.5570
AT3G16180 Major facilitator superfamily ... Lus10009506 62.3 0.5553
Lus10033149 63.1 0.5553
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10023215 63.8 0.5553
AT3G14040 Pectin lyase-like superfamily ... Lus10023364 64.6 0.5553
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027028 65.3 0.5553
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10003281 66.1 0.5553
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 66.8 0.5553

Lus10026642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.