Lus10026653 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13890 185 / 7e-59 ATSNAP30, SNAP30 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
AT5G61210 155 / 7e-47 SNP33, ATSNAP33B, SNAP33 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
AT5G07880 117 / 9e-33 ATSNAP29, SNAP29 ARABIDOPSIS THALIANA SYNAPTOSOMAL-ASSOCIATED PROTEIN SNAP25-LIKE 29, synaptosomal-associated protein SNAP25-like 29 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004660 276 / 1e-94 AT1G13890 349 / 4e-122 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10036893 265 / 5e-90 AT1G13890 335 / 2e-116 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10037092 262 / 4e-89 AT1G13890 327 / 1e-113 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Lus10034705 157 / 1e-47 AT5G61210 350 / 1e-121 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Lus10003466 157 / 3e-47 AT5G61210 379 / 1e-132 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Lus10015738 156 / 5e-47 AT5G61210 381 / 1e-133 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G093800 172 / 8e-54 AT1G13890 337 / 4e-117 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Potri.010G160350 172 / 1e-53 AT1G13890 266 / 2e-89 soluble N-ethylmaleimide-sensitive factor adaptor protein 30 (.1)
Potri.015G049000 162 / 2e-49 AT5G61210 403 / 3e-142 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
Potri.012G066700 148 / 4e-44 AT5G61210 360 / 3e-125 soluble N-ethylmaleimide-sensitive factor adaptor protein 33 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05739 SNARE SNARE domain
Representative CDS sequence
>Lus10026653 pacid=23164279 polypeptide=Lus10026653 locus=Lus10026653.g ID=Lus10026653.BGIv1.0 annot-version=v1.0
ATGGGCCCGGCCAAGAAGCCGTCGGCGGCGGAGAAGAAGAAGTACGAGAACGGGTTCAAGGACTCCGGCGGGCTGGAGGGCTACGCCGTGTATAAGGCGG
AGGAGACTACGAATACGGTGAATAATTGTTTGAGGATTGCTGAGGATATTAAGGGGGACGCTTCGAAGACGCTGGATATGGTGTTGTCAAATCCGCTCCC
ACAGAAAACCAAGGAGATCAATGGCCCTGTGATCACAGAAGACAAAACATCAAGGAAGAATGCAAACCACAGAACACAAAGAGAGAAGCTTGGGATAGGA
AACAAACCAGGAGCTAAATCAGCACCTGTAACTCCTCCCAATGAGCCCAGGAATGCAATGCAGAAAGTCGAGATGGAGAAGGCGAAGCAAGATGATGGAT
TATCAGACTTGAGTGACATCTTGGGAGATTTGAAAGGCATGGCTGTTGACATGGGCACTGAACTTGACAGGCAAACCAAAGCATTGGATCATCTCGATGG
CGACATCGATGAGCTCAACTCTAGAGTCAAAGGGGCCAACCAAAGTGCCCGCCATTTGCTTTCGAAATGA
AA sequence
>Lus10026653 pacid=23164279 polypeptide=Lus10026653 locus=Lus10026653.g ID=Lus10026653.BGIv1.0 annot-version=v1.0
MGPAKKPSAAEKKKYENGFKDSGGLEGYAVYKAEETTNTVNNCLRIAEDIKGDASKTLDMVLSNPLPQKTKEINGPVITEDKTSRKNANHRTQREKLGIG
NKPGAKSAPVTPPNEPRNAMQKVEMEKAKQDDGLSDLSDILGDLKGMAVDMGTELDRQTKALDHLDGDIDELNSRVKGANQSARHLLSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13890 ATSNAP30, SNAP3... soluble N-ethylmaleimide-sensi... Lus10026653 0 1
AT3G54070 Ankyrin repeat family protein ... Lus10038357 1.0 0.9440
Lus10007802 4.0 0.9300
AT5G05570 transducin family protein / WD... Lus10001254 4.2 0.9202
AT3G48560 TZP5, IMR1, ALS... TRIAZOLOPYRIMIDINE RESISTANT 5... Lus10032037 4.9 0.9149
AT2G22560 Kinase interacting (KIP1-like)... Lus10002655 5.3 0.8900
AT5G24318 O-Glycosyl hydrolases family 1... Lus10008865 8.1 0.8843
AT3G23770 O-Glycosyl hydrolases family 1... Lus10023226 10.0 0.9122
AT4G12310 CYP706A5 "cytochrome P450, family 706, ... Lus10024580 11.3 0.8887
AT3G49180 RID3 ROOT INITIATION DEFECTIVE 3, T... Lus10035930 11.6 0.8156
AT2G34930 disease resistance family prot... Lus10001035 12.4 0.8883

Lus10026653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.