Lus10026659 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69020 137 / 4e-38 Prolyl oligopeptidase family protein (.1)
AT5G66960 121 / 2e-32 Prolyl oligopeptidase family protein (.1)
AT1G50380 112 / 3e-29 Prolyl oligopeptidase family protein (.1)
AT1G20380 57 / 5e-10 Prolyl oligopeptidase family protein (.1)
AT1G76140 56 / 1e-09 Prolyl oligopeptidase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026683 219 / 3e-68 AT1G69020 785 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10004631 219 / 7e-68 AT1G69020 830 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10032378 211 / 1e-64 AT1G69020 372 / 1e-116 Prolyl oligopeptidase family protein (.1)
Lus10017568 129 / 3e-35 AT5G66960 1124 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10032920 110 / 1e-28 AT1G50380 1018 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10015387 107 / 1e-27 AT1G50380 1096 / 0.0 Prolyl oligopeptidase family protein (.1)
Lus10032964 66 / 2e-14 AT1G50380 206 / 4e-64 Prolyl oligopeptidase family protein (.1)
Lus10021235 61 / 3e-11 AT1G76140 1184 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Lus10034556 59 / 9e-11 AT1G76140 1056 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G137801 158 / 1e-45 AT1G69020 889 / 0.0 Prolyl oligopeptidase family protein (.1)
Potri.007G035900 124 / 1e-33 AT5G66960 1087 / 0.0 Prolyl oligopeptidase family protein (.1)
Potri.007G001300 112 / 3e-29 AT1G50380 1149 / 0.0 Prolyl oligopeptidase family protein (.1)
Potri.005G247400 63 / 3e-12 AT1G76140 1210 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.005G247300 61 / 2e-11 AT1G76140 1206 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.002G013900 59 / 7e-11 AT1G76140 1165 / 0.0 Prolyl oligopeptidase family protein (.1.2)
Potri.002G014000 57 / 5e-10 AT1G76140 1217 / 0.0 Prolyl oligopeptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF00326 Peptidase_S9 Prolyl oligopeptidase family
Representative CDS sequence
>Lus10026659 pacid=23164367 polypeptide=Lus10026659 locus=Lus10026659.g ID=Lus10026659.BGIv1.0 annot-version=v1.0
ATGACAGCGAATACTTCCCGGAACTCGAAAACTATTTCGGGAGGCGGTGGAGGCAGCGATTCTTCGTGGCATAGATCAGGCACCAAACTAGCCAAACCCA
ACTCTATTCATGATTTCTTGTCATGTGCGAGCTTCCTTGTAGATAAAAGGTATGAGCACAACAAGAAACTTGCTACCCAAGGTACAATTGCAGGAGGACT
CCTTGTTGCAGCTGCAATCAATATGAAGACTGATCTTTTTTGTGTCGCGATCTTGAAGGTTCCATTTCTGGATGTCTGCAACTCACTGTTGGATCCGAGC
TTGCCTCTAACCATACTCGACTATGAAGACTTCGGGAACCCACCGATTGAATCAGAGTTCGACTGCATCCGAAGCTACTCGCCTTACGATAACATCCAGT
GCGGGACGTGCCAGCCAGCAATGCTCGTCACATCATCATACAACGACTTGAGGTAA
AA sequence
>Lus10026659 pacid=23164367 polypeptide=Lus10026659 locus=Lus10026659.g ID=Lus10026659.BGIv1.0 annot-version=v1.0
MTANTSRNSKTISGGGGGSDSSWHRSGTKLAKPNSIHDFLSCASFLVDKRYEHNKKLATQGTIAGGLLVAAAINMKTDLFCVAILKVPFLDVCNSLLDPS
LPLTILDYEDFGNPPIESEFDCIRSYSPYDNIQCGTCQPAMLVTSSYNDLR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69020 Prolyl oligopeptidase family p... Lus10026659 0 1

Lus10026659 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.