Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26355 107 / 2e-31 SP1L1 SPIRAL1-like1 (.1) AT1G69230 98 / 8e-28 SP1L2 SPIRAL1-like2 (.1.2) AT2G03680 86 / 5e-23 SKU6, SPR1 spiral1 (.1.2) AT3G02180 78 / 1e-19 SP1L3 SPIRAL1-like3 (.1.2.3) AT5G15600 74 / 4e-18 SP1L4 SPIRAL1-like4 (.1) AT4G23496 65 / 8e-15 SP1L5 SPIRAL1-like5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026672 [exp] 119 / 3e-36 AT1G26355 149 / 4e-48 SPIRAL1-like1 (.1) Lus10004642 [exp] 115 / 1e-34 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10037069 [exp] 111 / 7e-33 AT1G26355 147 / 2e-47 SPIRAL1-like1 (.1) Lus10036916 [exp] 110 / 1e-32 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10000046 [exp] 110 / 1e-32 AT1G26355 146 / 7e-47 SPIRAL1-like1 (.1) Lus10034675 [exp] 86 / 8e-23 AT1G26355 127 / 5e-39 SPIRAL1-like1 (.1) Lus10032988 [exp] 71 / 6e-17 AT1G69230 99 / 8e-28 SPIRAL1-like2 (.1.2) Lus10024667 [exp] 65 / 4e-15 AT4G23496 74 / 2e-19 SPIRAL1-like5 (.1) Lus10032297 [exp] 65 / 8e-15 AT1G69230 98 / 7e-28 SPIRAL1-like2 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G097000 [exp] 99 / 3e-28 AT1G26355 127 / 2e-39 SPIRAL1-like1 (.1) Potri.010G157600 [exp] 97 / 4e-27 AT1G26355 120 / 1e-36 SPIRAL1-like1 (.1) Potri.015G059100 [exp] 85 / 2e-22 AT1G26355 98 / 1e-27 SPIRAL1-like1 (.1) Potri.017G095200 [exp] 84 / 2e-22 AT1G69230 94 / 2e-26 SPIRAL1-like2 (.1.2) Potri.001G100100 [exp] 67 / 9e-16 AT4G23496 81 / 2e-21 SPIRAL1-like5 (.1) Potri.003G131600 [exp] 64 / 1e-14 AT4G23496 81 / 4e-21 SPIRAL1-like5 (.1) Potri.T124504 [exp] 54 / 2e-09 AT1G19270 182 / 3e-53 DA1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026670 pacid=23164357 polypeptide=Lus10026670 locus=Lus10026670.g ID=Lus10026670.BGIv1.0 annot-version=v1.0 ATGGGTCGCGGAGTTAGCAGCGGTGGAGGGCAGAGTTCATTGGGATATCTATTCGGTAGCGGTGAAGCTCCCACCAAACCTGCTGCGAAAGCCGCCCCTA GTGAACCCGAGACTGTAAATGTTAAGCCAGCATCAGCTCCCAAACCGGCACCTCCCCCGGTCGACATCACCAAGCAGATTCCTGCTGGCATCAACAGCAC TTCGTCGAATAACTACATACGCGCCAGCGGTCAGAACGCGGGCAACTTCCTCACCGATCGACCTTCGACGAAGGTCCATGCTGCACCTGGTGGAGGGTCT TCTCTGGATTACCTGTTTGGTAATGGTGGTAGTAACTAG
AA sequence Show only first row Show all	>Lus10026670 pacid=23164357 polypeptide=Lus10026670 locus=Lus10026670.g ID=Lus10026670.BGIv1.0 annot-version=v1.0 MGRGVSSGGGQSSLGYLFGSGEAPTKPAAKAAPSEPETVNVKPASAPKPAPPPVDITKQIPAGINSTSSNNYIRASGQNAGNFLTDRPSTKVHAAPGGGS SLDYLFGNGGSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10026670 [exp]	0	1
AT5G67260		CYCD3;2	CYCLIN D3;2 (.1)		Lus10011507 [exp]	1.4	0.8811
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Lus10009323 [exp]	1.7	0.8963
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10026672 [exp]	5.0	0.8631
AT1G71970			unknown protein		Lus10009418 [exp]	8.7	0.8705
AT3G21350		MED6	RNA polymerase transcriptional...		Lus10022814 [exp]	14.5	0.8806
AT4G35230		BSK1	BR-signaling kinase 1 (.1)		Lus10021823 [exp]	18.8	0.8740
AT3G26780		MEF14	mitochondrial editing factor 1...		Lus10035155 [exp]	23.0	0.8768
AT1G34430		EMB3003	embryo defective 3003, 2-oxoac...		Lus10006069 [exp]	23.4	0.8713
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Lus10008623 [exp]	24.5	0.8422
AT3G03220		ATHEXPALPHA1.22...	EXPANSIN 13, expansin A13 (.1)		Lus10039009 [exp]	26.5	0.8763

Compare expression of checked genes

Lus10026670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.