Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13690 132 / 1e-40 ATE1 ATPase E1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004641 [exp] 171 / 4e-56 AT1G13690 277 / 8e-97 ATPase E1 (.1) Lus10014565 [exp] 171 / 4e-56 AT1G13690 277 / 9e-97 ATPase E1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G097500 [exp] 132 / 7e-41 AT1G13690 230 / 6e-78 ATPase E1 (.1) Potri.010G157000 [exp] 97 / 9e-27 AT1G13690 200 / 2e-66 ATPase E1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026675 pacid=23164243 polypeptide=Lus10026675 locus=Lus10026675.g ID=Lus10026675.BGIv1.0 annot-version=v1.0 ATGGACAACATGGACGGCGCCGAGCTCTACGGGAGGGTCCTCACCATTAACTATGCGCTCCCGGAGAAGATCAAGGGTGGTGAACAGGGATGGGCTGCTC AACCTATCTGGGCGGATGCTGATACATGGTTCGAGCGCCAGCAGCAAGAAGAGGAGATGCAGCGATATCAAGCGGAGAACCGCGCTGCAATGCAGGCTGC TGAGGACTTGCACAGAAAGAAACAGGCCGAGGAGCGAGATGGCGAGAAGGACGAAGCAGAGGACCCGATGGCTAGAGATGAAGCCGAAGTTTTGAACCAG AACGGTTTGAGCTAA
AA sequence Show only first row Show all	>Lus10026675 pacid=23164243 polypeptide=Lus10026675 locus=Lus10026675.g ID=Lus10026675.BGIv1.0 annot-version=v1.0 MDNMDGAELYGRVLTINYALPEKIKGGEQGWAAQPIWADADTWFERQQQEEEMQRYQAENRAAMQAAEDLHRKKQAEERDGEKDEAEDPMARDEAEVLNQ NGLS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13690		ATE1	ATPase E1 (.1)		Lus10026675 [exp]	0	1
AT3G54720		MFO1, HPT, COP2...	PRIMORDIA TIMING, Multifolia, ...		Lus10021090 [exp]	17.3	0.7599
					Lus10010342 [exp]	19.0	0.7555
AT1G52600			Peptidase S24/S26A/S26B/S26C f...		Lus10023131 [exp]	20.1	0.7568
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014044 [exp]	21.7	0.7426
AT3G49100			Signal recognition particle, S...		Lus10024862 [exp]	34.5	0.7388
AT2G15730			P-loop containing nucleoside t...		Lus10042667 [exp]	57.5	0.6879
					Lus10018751 [exp]	65.5	0.6837
AT1G71750		HGPT	Hypoxanthine-guanine phosphori...		Lus10024262 [exp]	83.3	0.6835
					Lus10030329 [exp]	104.8	0.6656
AT1G03360		ATRRP4	ribosomal RNA processing 4 (.1...		Lus10008171 [exp]	119.2	0.6804

Compare expression of checked genes

Lus10026675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.