Lus10026698 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23290 257 / 1e-89 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G70600 253 / 7e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 130 / 5e-40 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004617 291 / 4e-103 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10016336 286 / 5e-101 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10036855 280 / 2e-98 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10006207 280 / 2e-98 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10039528 275 / 7e-97 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10024161 273 / 4e-96 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 269 / 3e-94 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 266 / 3e-93 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 265 / 6e-93 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 265 / 8e-93 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10026698 pacid=23164329 polypeptide=Lus10026698 locus=Lus10026698.g ID=Lus10026698.BGIv1.0 annot-version=v1.0
ATGGCGACGGGATTGAAGAAGAACCGCAAGAAGAGGGGCCACGTCAGCGCCGGACACGGGCGTGTCGGAAAGCACCGCAAGCATCCCGGAGGCCGTGGTA
ACGCCGGAGGCATGCACCACCATAGGATCCTCTTCGACAAGTACCATCCAGGCTACTTCGGGAAAGTCGGGATGAGGTACTTCCACAAGCTGAAGAACAG
GTTCTTCTGCCCGATCGTCAACATCGACAAGCTCTGGTCGATGGTGCCTCAGGAGGTGAAGGACAAGGCCGCTAAAGAGGGAGGGGGTTCGGCTCCGATG
ATCGACGTCACTCAGTTTGGGTACTTCAAGGTTTTGGGGAAAGGTGTGTTGCCGGACAATCAGCCGATTGTGGTGAAGGCCAAGCTCGTTTCGAAGACTG
CTGAGAGGAAGATTAAGGAAGCTGGTGGCGCAGTTGTGCTCACTGCTTGA
AA sequence
>Lus10026698 pacid=23164329 polypeptide=Lus10026698 locus=Lus10026698.g ID=Lus10026698.BGIv1.0 annot-version=v1.0
MATGLKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSMVPQEVKDKAAKEGGGSAPM
IDVTQFGYFKVLGKGVLPDNQPIVVKAKLVSKTAERKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10026698 0 1
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10036855 1.0 0.9638
AT5G60670 Ribosomal protein L11 family p... Lus10019935 2.4 0.9467
AT1G07930 GTP binding Elongation factor ... Lus10015070 2.4 0.9242
AT5G60670 Ribosomal protein L11 family p... Lus10026506 4.9 0.9068
AT4G23620 Ribosomal protein L25/Gln-tRNA... Lus10011005 5.2 0.9049
AT3G16080 Zinc-binding ribosomal protein... Lus10035878 6.0 0.9106
AT4G36130 Ribosomal protein L2 family (.... Lus10025966 7.5 0.8866
AT4G36130 Ribosomal protein L2 family (.... Lus10028468 7.5 0.9187
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 9.5 0.9185
AT3G11250 Ribosomal protein L10 family p... Lus10014841 11.8 0.9086

Lus10026698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.