Lus10026700 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26510 126 / 7e-37 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT3G48240 125 / 1e-36 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G70640 117 / 2e-33 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT5G63130 116 / 4e-33 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 98 / 5e-25 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G46920 98 / 8e-24 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 96 / 4e-23 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT5G57610 94 / 2e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT1G04700 88 / 2e-20 PB1 domain-containing protein tyrosine kinase (.1)
AT2G01190 87 / 3e-20 PDE331 PIGMENT DEFECTIVE 331, Octicosapeptide/Phox/Bem1p family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000441 199 / 4e-66 AT3G48240 69 / 4e-15 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10006214 130 / 1e-38 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10036862 130 / 2e-38 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10019490 124 / 1e-35 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10043341 121 / 6e-35 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10002938 103 / 9e-28 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10017947 96 / 1e-25 AT5G63130 121 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 102 / 2e-25 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10019577 101 / 4e-25 AT3G46920 606 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G186500 169 / 2e-53 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.010G046400 156 / 6e-48 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.015G083400 120 / 9e-35 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G085000 119 / 3e-34 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G032200 99 / 1e-24 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 97 / 5e-24 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.018G114300 97 / 1e-23 AT3G46920 646 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.006G190200 97 / 2e-23 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.003G006200 94 / 2e-23 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G052000 93 / 4e-22 AT1G04700 721 / 0.0 PB1 domain-containing protein tyrosine kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10026700 pacid=23164349 polypeptide=Lus10026700 locus=Lus10026700.g ID=Lus10026700.BGIv1.0 annot-version=v1.0
ATGACGAATAACCTCAAATTCCTCTGCAGCTACGGAGGCAAGCTCGTCCCCCGCCACTCCGACGGAAAGCTCCGCTACCTCGGCGGCCAGACCCGCGTCC
TCGCCGTCGACCGCTCCATCTCCTTCTCCGATTTAGTGACGAAATTGGGGGACTTCGCCGGAACTCCGGTGAGCTTGCGGTGTCAATTGCCGGAGGCCGA
TCTGGACGATGCGTTAGTCTCGATAGTTTCCGACGAGGATCTGGCGAACTTGATCGAGGTGTACGACCGATTCTCGTCTCTAAAGATTCGGGCTTTCCTT
TCGATTCCGAGGAATCGGTCCTCTCCTCTGCTTTCCTCTTCATCTTCATCGTCGTTGTCGTCTTCCTCTTCGTCTTTGTCGTCAGCTTCGTCATCGAATT
CTTCCTCTGCTGCAACAATCGGTAGTCCAAGGTGTTCTCGGTGTCGGATTCCGAAACCACCGGCGAAGAAGGTTGCCGCCGGTTATTATGCTCCAGGGAG
CCATGGTGGTCGTGTGTACCTTGTACACAACGGGAATCACTGGCAATAA
AA sequence
>Lus10026700 pacid=23164349 polypeptide=Lus10026700 locus=Lus10026700.g ID=Lus10026700.BGIv1.0 annot-version=v1.0
MTNNLKFLCSYGGKLVPRHSDGKLRYLGGQTRVLAVDRSISFSDLVTKLGDFAGTPVSLRCQLPEADLDDALVSIVSDEDLANLIEVYDRFSSLKIRAFL
SIPRNRSSPLLSSSSSSSLSSSSSSLSSASSSNSSSAATIGSPRCSRCRIPKPPAKKVAAGYYAPGSHGGRVYLVHNGNHWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10026700 0 1
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10037156 1.4 0.9604
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10000441 2.2 0.9738
AT3G13750 BGAL1 beta-galactosidase 1, beta gal... Lus10015625 5.3 0.9413
AT5G57655 xylose isomerase family protei... Lus10001321 9.0 0.9558
AT5G57655 xylose isomerase family protei... Lus10006983 10.4 0.9537
AT4G19420 Pectinacetylesterase family pr... Lus10035682 11.5 0.9376
AT4G19420 Pectinacetylesterase family pr... Lus10037269 11.5 0.9383
AT1G10600 AMSH2 associated molecule with the S... Lus10030613 13.0 0.9496
AT1G21000 PLATZ transcription factor fam... Lus10000952 16.4 0.9536
AT4G34030 MCCB 3-methylcrotonyl-CoA carboxyla... Lus10019848 18.2 0.9453

Lus10026700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.