Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67910 56 / 7e-12 unknown protein AT1G24577 52 / 1e-10 unknown protein AT5G55980 45 / 3e-07 serine-rich protein-related (.1) AT3G56500 40 / 1e-05 serine-rich protein-related (.1) AT3G13227 39 / 4e-05 serine-rich protein-related (.1) AT5G20370 39 / 6e-05 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000442 [exp] 110 / 1e-33 AT1G67910 56 / 1e-11 unknown protein Lus10008880 [exp] 44 / 1e-06 AT5G55980 63 / 1e-13 serine-rich protein-related (.1) Lus10023227 [exp] 43 / 1e-06 AT5G55980 69 / 3e-16 serine-rich protein-related (.1) Lus10034901 [exp] 42 / 2e-06 AT1G67910 49 / 6e-09 unknown protein Lus10023632 [exp] 41 / 4e-06 AT1G67910 48 / 1e-08 unknown protein Lus10043215 [exp] 40 / 8e-06 AT5G55980 44 / 8e-07 serine-rich protein-related (.1) Lus10011094 [exp] 39 / 3e-05 AT5G55980 44 / 1e-06 serine-rich protein-related (.1) Lus10023630 [exp] 37 / 0.0003 AT1G67910 44 / 2e-07 unknown protein Lus10001946 [exp] 37 / 0.0004 AT5G11090 179 / 9e-57 serine-rich protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G046700 [exp] 63 / 1e-14 AT1G67910 82 / 4e-22 unknown protein Potri.008G186200 [exp] 62 / 3e-14 AT1G67910 85 / 4e-23 unknown protein Potri.018G079200 [exp] 45 / 8e-08 AT1G67910 45 / 9e-08 unknown protein Potri.001G371400 [exp] 42 / 5e-06 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.002G250700 [exp] 40 / 2e-05 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.006G060700 [exp] 38 / 0.0001 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.018G078900 [exp] 37 / 0.0001 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.006G159300 [exp] 37 / 0.0001 AT1G24577 43 / 5e-07 unknown protein Potri.018G120300 [exp] 37 / 0.0002 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026701 pacid=23164354 polypeptide=Lus10026701 locus=Lus10026701.g ID=Lus10026701.BGIv1.0 annot-version=v1.0 ATGGAGGATTCCCAGAGCAGAGTTCATGATCTCAAGGTTGATATTACTATGGACTGCAGCAACAACAATGGCAGAAAGTTTCAACCTTTATCAACTCCTT CTTCTTCTAGTAGCCATAGCAGTTGTAGCAAGAACACCACATCAGCTTGTCTTTGTTCTCCAACTTCCCATGTCGGGTCGTTCCGATGCAGGCTTCATCG GTCGCCTTCGCTTCAACGGACCAAGAGCATGGATGGTTCTTCTTAA
AA sequence Show only first row Show all	>Lus10026701 pacid=23164354 polypeptide=Lus10026701 locus=Lus10026701.g ID=Lus10026701.BGIv1.0 annot-version=v1.0 MEDSQSRVHDLKVDITMDCSNNNGRKFQPLSTPSSSSSHSSCSKNTTSACLCSPTSHVGSFRCRLHRSPSLQRTKSMDGSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67910			unknown protein		Lus10026701 [exp]	0	1
AT1G77420			alpha/beta-Hydrolases superfam...		Lus10034331 [exp]	4.9	0.8377
AT5G05760		ATSYP31, ATSED5...	T-SNARE SED 5, syntaxin of pla...		Lus10040213 [exp]	14.2	0.8541
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Lus10035193 [exp]	14.5	0.8243
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10018377 [exp]	15.7	0.7952
AT2G45170		ATATG8E	AUTOPHAGY 8E (.1.2)		Lus10004352 [exp]	17.4	0.8376
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Lus10041879 [exp]	17.5	0.8199
AT2G46550			unknown protein		Lus10012748 [exp]	19.6	0.8182
AT4G24230		ACBP3	acyl-CoA-binding domain 3 (.1....		Lus10007764 [exp]	20.9	0.8249
AT4G17830			Peptidase M20/M25/M40 family p...		Lus10040090 [exp]	22.4	0.8296
AT4G36195			Serine carboxypeptidase S28 fa...		Lus10028365 [exp]	23.1	0.8333

Compare expression of checked genes

Lus10026701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.