Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67900 185 / 8e-56 Phototropic-responsive NPH3 family protein (.1.2.3) AT2G14820 110 / 2e-28 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) AT4G37590 93 / 2e-22 MEL1, NPY5 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1) AT5G64330 91 / 9e-22 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) AT3G26490 87 / 4e-20 Phototropic-responsive NPH3 family protein (.1) AT1G30440 85 / 1e-19 Phototropic-responsive NPH3 family protein (.1) AT5G13600 84 / 2e-19 Phototropic-responsive NPH3 family protein (.1) AT4G31820 82 / 1e-18 MAB4, ENP, NPY1 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) AT1G03010 81 / 3e-18 Phototropic-responsive NPH3 family protein (.1) AT5G66560 81 / 4e-18 Phototropic-responsive NPH3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000443 [exp] 279 / 2e-91 AT1G67900 797 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Lus10014632 [exp] 109 / 5e-28 AT2G14820 741 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10033796 [exp] 107 / 2e-27 AT2G14820 735 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10025192 [exp] 102 / 1e-26 AT2G14820 248 / 2e-77 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10040484 [exp] 89 / 4e-21 AT5G64330 440 / 5e-150 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Lus10011290 [exp] 89 / 5e-21 AT5G64330 438 / 3e-149 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Lus10023274 [exp] 87 / 5e-20 AT1G30440 910 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10038531 [exp] 86 / 6e-20 AT1G30440 915 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10011525 [exp] 85 / 2e-19 AT4G37590 579 / 0.0 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G046800 [exp] 205 / 2e-63 AT1G67900 861 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Potri.008G186100 [exp] 201 / 6e-62 AT1G67900 833 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Potri.001G295600 [exp] 109 / 3e-28 AT2G14820 771 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.005G146400 [exp] 108 / 9e-28 AT2G14820 671 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.009G089500 [exp] 108 / 1e-27 AT2G14820 732 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.007G112600 [exp] 91 / 2e-21 AT5G64330 989 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Potri.017G048200 [exp] 90 / 2e-21 AT5G64330 993 / 0.0 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) Potri.018G018600 [exp] 87 / 3e-20 AT4G31820 630 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Potri.016G090400 [exp] 85 / 1e-19 AT5G03250 768 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.001G357100 [exp] 84 / 3e-19 AT1G30440 971 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03000 [flax] [poplar] NPH3 NPH3 family
Representative CDS sequence Show only first row Show all	>Lus10026702 pacid=23164259 polypeptide=Lus10026702 locus=Lus10026702.g ID=Lus10026702.BGIv1.0 annot-version=v1.0 ATGCAGGCACATCCGGACTTGAACAAGAGTGAGAGGAAGAGGCTATGCAGAATCTTGGACTGCAAGAAACTGTCAATGGAAGCATGTATGCATGCAGCAC AGAATGAGCTACTCCCACTTAGAGTAGTGGTACAAGTCCTCTTCTTTGAGCAAGCCAGAACAGCAATGTCCAACGGTGACAAAGTAACCGAGCTACCGAG CAACTTGAAGGCACTCCTGGCATCAAACGGGATCGACCCATCTTCGAGATCAATGGCTCCAGAGGACCAGTGGAGCAGTGTTTCTGCAGGGCTCAAATCC CCGAAGTCCTCGAAGCTGTCGACTTTGAGGATGAAGCTTGCCGAAGATCATGATGGTGACAATGACTTGGATGATGATATACAATCCGTAGGGCTTGGAA GTAGGTCTTCAAAGTTCAAGGCTTTCTGTGCTATCCCAACTAGGCCTAAGAAGATGTTCAGTAAATTGATGTCTATTAACAGAAGCTCAAGTGAAAAAAG TTGA
AA sequence Show only first row Show all	>Lus10026702 pacid=23164259 polypeptide=Lus10026702 locus=Lus10026702.g ID=Lus10026702.BGIv1.0 annot-version=v1.0 MQAHPDLNKSERKRLCRILDCKKLSMEACMHAAQNELLPLRVVVQVLFFEQARTAMSNGDKVTELPSNLKALLASNGIDPSSRSMAPEDQWSSVSAGLKS PKSSKLSTLRMKLAEDHDGDNDLDDDIQSVGLGSRSSKFKAFCAIPTRPKKMFSKLMSINRSSSEKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67900			Phototropic-responsive NPH3 fa...		Lus10026702 [exp]	0	1
AT1G67900			Phototropic-responsive NPH3 fa...		Lus10000443 [exp]	1.0	0.8563
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10023910 [exp]	8.5	0.7380
AT4G39150			DNAJ heat shock N-terminal dom...		Lus10028809 [exp]	20.4	0.7148
AT5G03530		ATRABALPHA, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10014409 [exp]	21.9	0.7110
AT5G28150			Plant protein of unknown funct...		Lus10022050 [exp]	22.6	0.7229
AT2G01930	BBR_BPC	BPC1, BBR/BPC1,...	basic pentacysteine1 (.1.2)		Lus10023543 [exp]	24.1	0.6986
AT1G69010	bHLH	bHLH102, BIM2	BES1-interacting Myc-like prot...		Lus10004630 [exp]	30.0	0.6764
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10041571 [exp]	36.7	0.6676
AT5G06440			unknown protein		Lus10021251 [exp]	38.5	0.6898
AT5G41790		CIP1	COP1-interactive protein 1 (.1...		Lus10032362 [exp]	46.0	0.6545

Compare expression of checked genes

Lus10026702 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.