Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36930 57 / 8e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72890 54 / 1e-09 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT1G72920 52 / 4e-09 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G17615 50 / 2e-08 Disease resistance protein (TIR-NBS class) (.1) AT1G72950 50 / 3e-08 Disease resistance protein (TIR-NBS class) (.1) AT1G72930 48 / 7e-08 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72940 49 / 8e-08 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT4G09430 47 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72840 47 / 3e-07 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT3G04220 47 / 3e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025497 [exp] 130 / 2e-39 AT5G36930 126 / 3e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008415 [exp] 94 / 1e-25 AT5G36930 137 / 5e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020536 [exp] 96 / 4e-24 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2) Lus10026961 [exp] 93 / 2e-23 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020534 [exp] 93 / 3e-23 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020537 [exp] 92 / 6e-23 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10020524 [exp] 91 / 1e-22 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10001040 [exp] 88 / 1e-22 AT5G36930 167 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020533 [exp] 89 / 1e-21 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G046000 [exp] 65 / 1e-13 AT5G36930 496 / 1e-162 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 65 / 1e-13 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 65 / 2e-13 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001933 [exp] 65 / 2e-13 AT5G36930 617 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001314 [exp] 64 / 2e-13 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T005501 [exp] 64 / 5e-13 AT5G36930 612 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G014200 [exp] 63 / 6e-13 AT5G36930 673 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 63 / 7e-13 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 63 / 7e-13 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 63 / 7e-13 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10026707 pacid=23176598 polypeptide=Lus10026707 locus=Lus10026707.g ID=Lus10026707.BGIv1.0 annot-version=v1.0 ATGTCCAATCCTGAAGAGTACGAGGTTTTCTTGAGCTTCAAAGGTCTCGATGTCTGCCAAACATTTGCGAACCCCCTCCGCACTTGCCTTGTTCGTTCCG GTATTCACACGTTTGTCAATGACGAAGAGCTCTCAAAGTGGGAAGCCATCGGCCCGTCCCTTGTCAAACCTATAACCAAGTCCAAGATCCTTATCCGAGA ACTATGCTTCCTGCAAATGGTGTCTCCGGGAGCTAGCTACAGTGGTCCTTACAAGGAAGCATTTGAACAACACAGCCTGAAGCATGATCCTATGACTGTA ATGAAATGA
AA sequence Show only first row Show all	>Lus10026707 pacid=23176598 polypeptide=Lus10026707 locus=Lus10026707.g ID=Lus10026707.BGIv1.0 annot-version=v1.0 MSNPEEYEVFLSFKGLDVCQTFANPLRTCLVRSGIHTFVNDEELSKWEAIGPSLVKPITKSKILIRELCFLQMVSPGASYSGPYKEAFEQHSLKHDPMTV MK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G36930			Disease resistance protein (TI...		Lus10026707 [exp]	0	1
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10033877 [exp]	1.0	0.9332
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10029812 [exp]	1.4	0.8086
AT1G04560			AWPM-19-like family protein (....		Lus10033541 [exp]	2.4	0.7271
AT3G04060	NAC	ANAC046	NAC domain containing protein ...		Lus10033699 [exp]	10.2	0.7093
					Lus10014737 [exp]	11.4	0.7093
AT1G04520		PDLP2	plasmodesmata-located protein ...		Lus10028049 [exp]	12.5	0.7093
					Lus10019558 [exp]	13.5	0.7093
AT4G16195			Plant self-incompatibility pro...		Lus10019768 [exp]	14.4	0.7093
					Lus10021773 [exp]	15.3	0.7093
AT1G08510		FATB	fatty acyl-ACP thioesterases B...		Lus10035900 [exp]	16.1	0.7093

Compare expression of checked genes

Lus10026707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.