Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44590 72 / 9e-18 60S acidic ribosomal protein family (.1.2) AT2G27710 67 / 9e-16 60S acidic ribosomal protein family (.1.2.3.4) AT2G27720 57 / 7e-12 60S acidic ribosomal protein family (.1.2.3) AT3G28500 57 / 9e-12 60S acidic ribosomal protein family (.1) AT5G40040 56 / 3e-11 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026712 [exp] 108 / 2e-30 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2) Lus10043377 [exp] 91 / 2e-24 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4) Lus10019533 [exp] 91 / 7e-23 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2) Lus10020575 [exp] 85 / 1e-22 AT3G44590 100 / 9e-29 60S acidic ribosomal protein family (.1.2) Lus10006270 [exp] 88 / 2e-22 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4) Lus10019846 [exp] 81 / 4e-21 AT2G27710 92 / 2e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10014070 [exp] 80 / 1e-20 AT2G27710 92 / 1e-25 60S acidic ribosomal protein family (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G146200 [exp] 83 / 9e-22 AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.004G185800 [exp] 83 / 1e-21 AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.010G236400 [exp] 73 / 6e-18 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10026714 pacid=23176612 polypeptide=Lus10026714 locus=Lus10026714.g ID=Lus10026714.BGIv1.0 annot-version=v1.0 ATGAAGCTTGTCGCCGCCTACCTGCTCGCCGTTCTGGGAGGCAACACCACTCCCACCGCCGATGACTTGAAGTCTATCCTCGCTAGCGTGGGTGCTGACG CCGATAATGAGAAGATCGAGTTTCTCCTGTCCCAAGTGAAAGGAAGAGACAGCGCAGAGATGATCGCCTCTGGTTTGGAGAAGTTGGCCTCCGTGCCTTC TGGTGGAGGCAGCTGCGGTGCAGTTGCTGATTCTGCAGCAGCCCCAGCCGGTGTTTCTGCACCAGCGGCAGAGGCAAAGAAGGAAGAGAAGGTTGAGGAT AAAGAGGAGTCTGATGGGGTAATTCATTAA
AA sequence Show only first row Show all	>Lus10026714 pacid=23176612 polypeptide=Lus10026714 locus=Lus10026714.g ID=Lus10026714.BGIv1.0 annot-version=v1.0 MKLVAAYLLAVLGGNTTPTADDLKSILASVGADADNEKIEFLLSQVKGRDSAEMIASGLEKLASVPSGGGSCGAVADSAAAPAGVSAPAAEAKKEEKVED KEESDGVIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44590			60S acidic ribosomal protein f...		Lus10026714 [exp]	0	1
AT3G29635			HXXXD-type acyl-transferase fa...		Lus10021388 [exp]	1.0	0.8971
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Lus10001068 [exp]	7.9	0.8663
AT1G32640	bHLH	JIN1, JAI1, ZBF...	JASMONATE INSENSITIVE 1, Basic...		Lus10005999 [exp]	14.2	0.8929
AT2G35300		AtLEA4-2, LEA18	late embryogenesis abundant 18...		Lus10043356 [exp]	16.0	0.8063
AT1G48960			Adenine nucleotide alpha hydro...		Lus10027236 [exp]	22.7	0.8934
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10013802 [exp]	22.9	0.8370
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10025749 [exp]	27.4	0.8875
AT5G08100		ASPGA1	asparaginase A1, N-terminal nu...		Lus10017879 [exp]	27.7	0.8900
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	31.6	0.8879
AT3G26170		CYP71B19	"cytochrome P450, family 71, s...		Lus10018261 [exp]	33.1	0.8912

Compare expression of checked genes

Lus10026714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.