Lus10026719 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025507 108 / 5e-30 AT3G18990 91 / 1e-21 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Lus10026724 95 / 6e-25 AT4G33280 42 / 2e-04 AP2/B3-like transcriptional factor family protein (.1)
Lus10025534 91 / 2e-23 AT3G18990 81 / 2e-18 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Lus10025505 71 / 5e-16 ND 41 / 5e-04
Lus10009734 52 / 5e-09 AT5G16630 49 / 1e-06 DNA repair protein Rad4 family (.1.2)
Lus10025533 46 / 1e-06 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10009688 39 / 0.0002 AT3G18990 113 / 2e-28 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026719 pacid=23176584 polypeptide=Lus10026719 locus=Lus10026719.g ID=Lus10026719.BGIv1.0 annot-version=v1.0
ATGGACAGCTTAAGTGTTGATGCCGCTGCTGCAAATGAGAAAGGAAAATCTCCGATGGTTGATGATTCTGCAGGCTTGGATGATGGTTCTGAAAATCGAT
TGGGATCAGCACATCCCTCTTTCGAGATCAAAATCCAGCGAAGTTATCTGAATACTGACCGGCAAGGATGTATACCATTAACTTTTACGAGGCAACACCC
GTTCTTGAGAGATGTGAAGAAGGTGAAGCTAGAGGTAGGGGAGAAGGTTTGGCCAATAACGACCTCGCTCGATCGTGGCATTTATGTCAGGCTCGGCGGT
GGCTGGAGTGGGTTCGCGAAAGAAAACTCGCTCGAACTCTAA
AA sequence
>Lus10026719 pacid=23176584 polypeptide=Lus10026719 locus=Lus10026719.g ID=Lus10026719.BGIv1.0 annot-version=v1.0
MDSLSVDAAAANEKGKSPMVDDSAGLDDGSENRLGSAHPSFEIKIQRSYLNTDRQGCIPLTFTRQHPFLRDVKKVKLEVGEKVWPITTSLDRGIYVRLGG
GWSGFAKENSLEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026719 0 1
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10026720 1.0 0.8193
Lus10041155 14.1 0.7544
AT1G63440 HMA5 heavy metal atpase 5 (.1) Lus10008309 18.6 0.8153
AT1G51940 protein kinase family protein ... Lus10026689 20.0 0.6970
AT3G52190 AtPHF1, PHF1 phosphate transporter traffic ... Lus10028830 23.9 0.7878
AT1G26690 emp24/gp25L/p24 family/GOLD fa... Lus10026625 24.6 0.7800
AT1G21240 WAK3 wall associated kinase 3 (.1) Lus10013387 26.2 0.7900
AT3G22640 PAP85 cupin family protein (.1) Lus10022072 39.2 0.7796
Lus10022031 42.1 0.7734
AT1G10390 Nucleoporin autopeptidase (.1.... Lus10033256 44.2 0.7768

Lus10026719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.