Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02710 133 / 1e-37 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010958 [exp] 0 / 1 AT3G02710 780 / 0.0 ARM repeat superfamily protein (.1) Lus10031364 [exp] 0 / 1 AT3G02710 772 / 0.0 ARM repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G076600 [exp] 136 / 8e-39 AT3G02710 696 / 0.0 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026721 pacid=23176591 polypeptide=Lus10026721 locus=Lus10026721.g ID=Lus10026721.BGIv1.0 annot-version=v1.0 ATGTTGCAGGCGGTGGCCATGTACAAGTCCAAGGATTCTAAGAGCTCCGACGAAGAGGAAATGGTGGATAATTTATTCGATTGTTTGTGTTGTTTGCTGA TGCGTTTGCAGAACAAGGTCAAGGAGAGGTTTGTCATGGTGGAAGGTGTGGAGTTGATGATTATGATTATGAAGCAGAAGAAGTCTGCTTACAGTTCGGC TATTAGAGCTCTTGATTACGCCATGACAAAGAATCCACCAGCTAGCGAGCGGTTTGTTGATGTTCTCGGATTGAAGACTGCATTCGCTGGTTTCATGGAT TCCAATGAGCAAGAAGAAAAAGAAGGAAAGCTACCAAGAGGAGTTAGAAGAGCGGATTATTTCCCTAATTGCATCATTATTTGGTAA
AA sequence Show only first row Show all	>Lus10026721 pacid=23176591 polypeptide=Lus10026721 locus=Lus10026721.g ID=Lus10026721.BGIv1.0 annot-version=v1.0 MLQAVAMYKSKDSKSSDEEEMVDNLFDCLCCLLMRLQNKVKERFVMVEGVELMIMIMKQKKSAYSSAIRALDYAMTKNPPASERFVDVLGLKTAFAGFMD SNEQEEKEGKLPRGVRRADYFPNCIIIW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G02710			ARM repeat superfamily protein...		Lus10026721 [exp]	0	1
					Lus10003137 [exp]	1.0	0.9071
AT5G05360			unknown protein		Lus10012213 [exp]	2.0	0.9026
AT1G08845			Ribosomal L18p/L5e family prot...		Lus10001727 [exp]	3.5	0.8810
AT5G54850			unknown protein		Lus10043054 [exp]	6.3	0.8744
AT5G45920			SGNH hydrolase-type esterase s...		Lus10000525 [exp]	7.0	0.8784
AT3G62140			unknown protein		Lus10038035 [exp]	7.7	0.8861
AT5G59560		SRR1	SENSITIVITY TO RED LIGHT REDUC...		Lus10039536 [exp]	8.1	0.8713
AT3G60360		EDA14, UTP11	U3 SMALL NUCLEOLAR RNA-ASSOCIA...		Lus10034210 [exp]	12.3	0.8749
AT5G53070			Ribosomal protein L9/RNase H1 ...		Lus10022383 [exp]	12.8	0.8826
AT1G24120		ARL1	ARG1-like 1 (.1)		Lus10030827 [exp]	16.6	0.8818

Compare expression of checked genes

Lus10026721 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.