Lus10026732 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43280 88 / 2e-22 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
AT3G07500 62 / 1e-12 FAR1_related Far-red impaired responsive (FAR1) family protein (.1)
AT4G12850 59 / 2e-11 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
AT2G27110 52 / 2e-08 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.3)
AT3G59470 48 / 2e-07 FAR1_related Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2)
AT2G32250 48 / 4e-07 FAR1_related FRS2 FAR1-related sequence 2 (.1.2.3.4)
AT4G15090 45 / 4e-06 FAR1_related FAR1 FAR-RED IMPAIRED RESPONSE 1, FRS (FAR1 Related Sequences) transcription factor family (.1)
AT4G38180 44 / 6e-06 FAR1_related FRS5 FAR1-related sequence 5 (.1)
AT1G80010 42 / 4e-05 FAR1_related FRS8 FAR1-related sequence 8 (.1)
AT5G18960 42 / 5e-05 FAR1_related FRS12 FAR1-related sequence 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025517 109 / 5e-32 AT2G43280 87 / 1e-22 Far-red impaired responsive (FAR1) family protein (.1)
Lus10022979 50 / 2e-08 AT4G38180 85 / 8e-20 FAR1-related sequence 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G029400 89 / 8e-23 AT2G43280 319 / 4e-112 Far-red impaired responsive (FAR1) family protein (.1)
Potri.007G129101 85 / 4e-22 AT2G43280 142 / 6e-44 Far-red impaired responsive (FAR1) family protein (.1)
Potri.002G239400 71 / 7e-16 AT4G12850 207 / 1e-68 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Potri.014G176500 69 / 3e-15 AT3G07500 275 / 2e-94 Far-red impaired responsive (FAR1) family protein (.1)
Potri.014G176600 65 / 1e-13 AT4G12850 178 / 5e-57 Far-red impaired responsive (FAR1) family protein (.1), Far-red impaired responsive (FAR1) family protein (.2), Far-red impaired responsive (FAR1) family protein (.3)
Potri.009G158400 64 / 7e-13 AT2G27110 1138 / 0.0 FAR1-related sequence 3 (.1.2.3)
Potri.007G129000 61 / 2e-12 AT2G43280 133 / 9e-40 Far-red impaired responsive (FAR1) family protein (.1)
Potri.005G257600 62 / 6e-12 AT4G38180 891 / 0.0 FAR1-related sequence 5 (.1)
Potri.002G239300 61 / 8e-12 AT2G43280 130 / 2e-37 Far-red impaired responsive (FAR1) family protein (.1)
Potri.004G196300 61 / 9e-12 AT2G27110 1115 / 0.0 FAR1-related sequence 3 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10026732 pacid=23176627 polypeptide=Lus10026732 locus=Lus10026732.g ID=Lus10026732.BGIv1.0 annot-version=v1.0
ATGGAGGATTCTCCTGGACAGGACATGGTCGGAGCAGTAGATGAAGACGAGTCGATTGTAGAACCATGTGAGGGTATGGAATTTGATTCAGAAGATGCTG
TTAAGATGTTCTATGATGAATATGCTCGGAAACTAGGATTTGTCATGCGTGTGATGACTTGTCGTCGTTCTGAAAGGAATGGGAGGATTGTTGCCTCTGC
AGTTGAGGATGAGAAGGACAAGCGGATTCAAGAACTGACGATGGAGATGCGGAACAAGAAGCGGTTATGCACCATGTATCAACAACAGCTGACAGCATTC
ATTAAGATCGTCGAAGAGCATAACGAGCAACTGTCAATGAAAGTTGAAAATGTAGTGAAAGATATCAAAGAGGTTGAACCTATAGAAGAGCAGTAG
AA sequence
>Lus10026732 pacid=23176627 polypeptide=Lus10026732 locus=Lus10026732.g ID=Lus10026732.BGIv1.0 annot-version=v1.0
MEDSPGQDMVGAVDEDESIVEPCEGMEFDSEDAVKMFYDEYARKLGFVMRVMTCRRSERNGRIVASAVEDEKDKRIQELTMEMRNKKRLCTMYQQQLTAF
IKIVEEHNEQLSMKVENVVKDIKEVEPIEEQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07500 FAR1_related Far-red impaired responsive (F... Lus10026732 0 1
Lus10032721 5.5 0.7553
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10011717 7.1 0.7876
Lus10017219 12.2 0.7841
AT2G39260 binding;RNA binding (.1) Lus10030801 13.4 0.7837
AT1G61100 disease resistance protein (TI... Lus10025112 17.2 0.7778
AT2G32760 unknown protein Lus10022575 18.2 0.7481
AT4G24190 AtHsp90-7, HSP9... SHEPHERD, HEAT SHOCK PROTEIN 9... Lus10035109 20.2 0.7767
AT5G45190 Cyclin family protein (.1.2) Lus10018272 24.2 0.7833
AT4G05440 EDA35 embryo sac development arrest ... Lus10000812 26.3 0.7595
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10008065 29.0 0.7486

Lus10026732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.