Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G21090 248 / 9e-85 Leucine-rich repeat (LRR) family protein (.1) AT3G43740 241 / 7e-82 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) AT1G71830 186 / 3e-56 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT4G33430 182 / 6e-55 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) AT1G34210 182 / 1e-54 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT2G13790 172 / 4e-51 BAK7, BKK1, ATSERK4 BAK1-LIKE 1, BRI1- ASSOCIATED KINASE 7, somatic embryogenesis receptor-like kinase 4 (.1) AT2G13800 154 / 3e-44 BAK8, ATSERK5 BRI1- ASSOCIATED KINASE 8, SOMATIC EMBRYOGENESIS RECEPTOR LIKE KINASE 5, somatic embryogenesis receptor-like kinase 5 (.1) AT5G10290 115 / 5e-30 leucine-rich repeat transmembrane protein kinase family protein (.1) AT3G25560 105 / 2e-26 NIK2 NSP-interacting kinase 2 (.1.2.3) AT4G30520 102 / 2e-25 SARK SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE, Leucine-rich repeat protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002579 [exp] 197 / 3e-64 AT5G21090 275 / 3e-94 Leucine-rich repeat (LRR) family protein (.1) Lus10001807 [exp] 189 / 3e-61 AT5G21090 227 / 9e-76 Leucine-rich repeat (LRR) family protein (.1) Lus10002117 [exp] 187 / 1e-60 AT3G43740 273 / 9e-94 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Lus10013902 [exp] 192 / 3e-57 AT1G49870 454 / 2e-145 unknown protein Lus10020962 [exp] 189 / 4e-57 AT4G33430 989 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Lus10028716 [exp] 186 / 2e-56 AT1G71830 1000 / 0.0 somatic embryogenesis receptor-like kinase 1 (.1) Lus10004958 [exp] 172 / 9e-55 AT1G34210 215 / 2e-66 somatic embryogenesis receptor-like kinase 2 (.1) Lus10042755 [exp] 167 / 1e-52 AT5G21090 199 / 8e-65 Leucine-rich repeat (LRR) family protein (.1) Lus10000196 [exp] 123 / 4e-37 AT5G21090 104 / 7e-30 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G018800 [exp] 253 / 2e-86 AT5G21090 354 / 6e-126 Leucine-rich repeat (LRR) family protein (.1) Potri.001G219500 [exp] 250 / 1e-85 AT5G21090 348 / 2e-123 Leucine-rich repeat (LRR) family protein (.1) Potri.001G061600 [exp] 202 / 1e-66 AT5G21090 272 / 2e-93 Leucine-rich repeat (LRR) family protein (.1) Potri.003G166200 [exp] 202 / 2e-66 AT5G21090 275 / 2e-94 Leucine-rich repeat (LRR) family protein (.1) Potri.001G296500 [exp] 195 / 7e-64 AT3G43740 278 / 1e-95 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.009G090700 [exp] 190 / 7e-62 AT3G43740 270 / 2e-92 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2) Potri.003G023000 [exp] 186 / 5e-56 AT4G33430 961 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.001G206700 [exp] 184 / 1e-55 AT4G33430 927 / 0.0 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2) Potri.019G087700 [exp] 182 / 2e-54 AT1G34210 1012 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1) Potri.007G082400 [exp] 179 / 2e-53 AT1G34210 954 / 0.0 somatic embryogenesis receptor-like kinase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat CL0022 [flax] [poplar] PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10026751 pacid=23176637 polypeptide=Lus10026751 locus=Lus10026751.g ID=Lus10026751.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCTGCACCTCTCATCTTCGCTGCTGTTGCTCTAGCCCTGTGCTTCCCTCTCGCGTTTGCGAATTCGGAAGGAGATGCTCTCTACACACTTA GGAGGAGCTTGTCCGATCCGGATAACGTCCTCCAGAGCTGGGATCCGACCTTAGTCAACCCTTGCACTTGGTTCCACATCACCTGCAACCAGGATAACCG CGTTACCCGAGTGGACTTGGGGAATTCAAATTTGTCTGGGCATCTAGTGTCTGAGCTTGGGAAGCTAGAGCACTTACAGTATCTGGAGCTCTACAAAAAC AACCTTCATGGAACTATCCCTGCTGAGCTTGGTAACTTGAAGAATCTGATCAGCTTGGACTTATACAACAACAACATAACCGGGACTATCCCTTCTTCGC TTGGGGAATTGATTTCGCTTGGGAAATTGAAGAGTCTAGTCTTTTTAGATGTTACGAACAATGACTTGTGTGGAACTATTCCAACAACTGGACCATTCGA GCATATCCCACTAAACAAATGA
AA sequence Show only first row Show all	>Lus10026751 pacid=23176637 polypeptide=Lus10026751 locus=Lus10026751.g ID=Lus10026751.BGIv1.0 annot-version=v1.0 MAAAAPLIFAAVALALCFPLAFANSEGDALYTLRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRVDLGNSNLSGHLVSELGKLEHLQYLELYKN NLHGTIPAELGNLKNLISLDLYNNNITGTIPSSLGELISLGKLKSLVFLDVTNNDLCGTIPTTGPFEHIPLNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G21090			Leucine-rich repeat (LRR) fami...		Lus10026751 [exp]	0	1
AT2G37550		ASP1, AGD7	yeast pde1 suppressor 1, ARF-G...		Lus10023766 [exp]	2.4	0.8679
					Lus10038116 [exp]	3.2	0.8421
AT2G36320			A20/AN1-like zinc finger famil...		Lus10035603 [exp]	5.7	0.8406
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10021423 [exp]	5.7	0.8552
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Lus10032835 [exp]	6.9	0.8449
AT5G59300		ATUBC7, UBC7	ARABIDOPSIS THALIANA UBIQUITIN...		Lus10016573 [exp]	10.2	0.8370
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Lus10043112 [exp]	10.4	0.8601
AT5G06280			unknown protein		Lus10016973 [exp]	10.9	0.8456
AT1G79590		ATSYP52, SYP52	syntaxin of plants 52 (.1.2)		Lus10016577 [exp]	14.5	0.8366
AT2G02970			GDA1/CD39 nucleoside phosphata...		Lus10012825 [exp]	15.8	0.8467

Compare expression of checked genes

Lus10026751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.