Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27080 110 / 5e-31 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT5G21130 96 / 4e-25 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06320 47 / 4e-07 NHL3 NDR1/HIN1-like 3 (.1) AT2G27260 46 / 1e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 40 / 9e-05 NHL2 NDR1/HIN1-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025548 [exp] 226 / 3e-78 AT2G27080 107 / 1e-29 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Lus10031317 [exp] 58 / 4e-11 AT1G54540 231 / 1e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031888 [exp] 57 / 1e-10 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007364 [exp] 51 / 1e-08 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 50 / 3e-08 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10000688 [exp] 41 / 5e-05 AT2G22180 98 / 1e-23 hydroxyproline-rich glycoprotein family protein (.1) Lus10037638 [exp] 39 / 0.0003 AT1G17620 201 / 4e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10019667 [exp] 38 / 0.0006 AT2G22180 102 / 3e-25 hydroxyproline-rich glycoprotein family protein (.1) Lus10016800 [exp] 38 / 0.0006 AT2G22180 88 / 4e-20 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G197600 [exp] 125 / 1e-36 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.009G158900 [exp] 124 / 5e-36 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.005G166600 [exp] 67 / 2e-14 AT2G27080 114 / 2e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.017G154000 [exp] 51 / 1e-08 AT1G54540 242 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G067100 [exp] 43 / 7e-06 AT1G54540 203 / 3e-65 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.005G077100 [exp] 43 / 9e-06 AT2G22180 111 / 8e-29 hydroxyproline-rich glycoprotein family protein (.1) Potri.016G071600 [exp] 41 / 4e-05 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.018G052500 [exp] 40 / 0.0001 AT5G11890 198 / 3e-62 EMBRYO DEFECTIVE 3135, unknown protein Potri.001G200700 [exp] 39 / 0.0003 AT1G17620 168 / 2e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G228600 [exp] 38 / 0.0006 AT5G11890 171 / 4e-52 EMBRYO DEFECTIVE 3135, unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [flax] [poplar] E-set PF03168 [flax] [poplar] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Lus10026762 pacid=23176561 polypeptide=Lus10026762 locus=Lus10026762.g ID=Lus10026762.BGIv1.0 annot-version=v1.0 ATGGAGATGCTTTACCGGGCGGGGAGCTCCGCCGCCGTGTACTACAACGGGATCGAGTTGGGGACCGGTTCTGTTCCGGTTTTCGACCAGGGCAAGAATC AGGTGACGACGTTTGCGGCGGCGTTGAAAGGGAACGGGATTTTGTTGACGGGAGCCGTGCAACGGTCGTTGAAGGGTGCGGCGTCGTTTAAGCTGAACAT GAGGGCTCCCGTTAAGTTTAGGTTAGGTGGGGTGAAATCGTGGACGTTTACTGCTAAAGTTGACTGTGATGTGACGGTGGATAAGTTGACGGCAAATGCT ACCGTCGTTTCGCAGCAATGTGGTTACGACGTCGACGTTTGGTAG
AA sequence Show only first row Show all	>Lus10026762 pacid=23176561 polypeptide=Lus10026762 locus=Lus10026762.g ID=Lus10026762.BGIv1.0 annot-version=v1.0 MEMLYRAGSSAAVYYNGIELGTGSVPVFDQGKNQVTTFAAALKGNGILLTGAVQRSLKGAASFKLNMRAPVKFRLGGVKSWTFTAKVDCDVTVDKLTANA TVVSQQCGYDVDVW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27080			Late embryogenesis abundant (L...		Lus10026762 [exp]	0	1
AT1G61740			Sulfite exporter TauE/SafE fam...		Lus10020068 [exp]	2.8	0.9041
AT4G10265			Wound-responsive family protei...		Lus10039754 [exp]	6.2	0.8583
AT3G17390		MAT4, SAMS3, MT...	S-ADENOSYLMETHIONINE SYNTHETAS...		Lus10038044 [exp]	6.4	0.9054
AT5G42050			DCD (Development and Cell Deat...		Lus10023059 [exp]	7.0	0.8734
AT3G17390		MAT4, SAMS3, MT...	S-ADENOSYLMETHIONINE SYNTHETAS...		Lus10009985 [exp]	9.5	0.8948
AT3G22060			Receptor-like protein kinase-r...		Lus10039699 [exp]	9.7	0.8518
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10033585 [exp]	9.7	0.7924
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10002853 [exp]	10.0	0.8652
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10004984 [exp]	10.4	0.8347
AT2G43590			Chitinase family protein (.1)		Lus10035620 [exp]	10.6	0.8321

Compare expression of checked genes

Lus10026762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.