Lus10026767 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27110 145 / 5e-41 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G158400 156 / 8e-45 AT2G27110 1138 / 0.0 FAR1-related sequence 3 (.1.2.3)
Potri.004G196300 151 / 4e-43 AT2G27110 1115 / 0.0 FAR1-related sequence 3 (.1.2.3)
Potri.008G011800 128 / 6e-35 AT2G27110 947 / 0.0 FAR1-related sequence 3 (.1.2.3)
Potri.013G068900 72 / 8e-16 AT2G27110 96 / 3e-22 FAR1-related sequence 3 (.1.2.3)
Potri.012G097200 55 / 7e-10 AT2G27110 56 / 4e-09 FAR1-related sequence 3 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10026767 pacid=23176582 polypeptide=Lus10026767 locus=Lus10026767.g ID=Lus10026767.BGIv1.0 annot-version=v1.0
ATGTCCATTAAGCGAGAGGATGTACCTACTGTAAATATGGCGGCAGTTTATTTTCATCTTAAAGCAATGACCTGGGAGATGGAAAACAAGAGTGCCATCC
CAAGAATTAGAGTAGCTGTTATTCACCTAAAGTTGCAAGATTACAGCAAGACTCCAGCCGTTGACTTTGACGTCAAGTTTCAACTCTCGAAAGTCTCGTT
AGAGCCCATGATGAAGTCTATGACAAGCGTCAACGAGCAGCCCTCAAATACAGCTAGCAGTGTTACTGTTATTAACTTAGAGCTTCGCGAGACTGAAACT
AGTCCAGGAGAGCCAGTGGTCGTTAGGTTCAAGGTCTCGAAAGGGACTCTAGCTGCTATGTTGGCATCGATGTCCTACATACGCAAACAGCTCTCAAACA
CTGTGGAGCCGTCGTCAGCAGAGTCTCGTGCTTATAAGAAGCAACGGAAGTGA
AA sequence
>Lus10026767 pacid=23176582 polypeptide=Lus10026767 locus=Lus10026767.g ID=Lus10026767.BGIv1.0 annot-version=v1.0
MSIKREDVPTVNMAAVYFHLKAMTWEMENKSAIPRIRVAVIHLKLQDYSKTPAVDFDVKFQLSKVSLEPMMKSMTSVNEQPSNTASSVTVINLELRETET
SPGEPVVVRFKVSKGTLAAMLASMSYIRKQLSNTVEPSSAESRAYKKQRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G27110 FAR1_related FRS3 FAR1-related sequence 3 (.1.2.... Lus10026767 0 1
AT4G11560 bromo-adjacent homology (BAH) ... Lus10008492 1.4 0.8857
AT5G27410 D-aminoacid aminotransferase-l... Lus10035342 2.4 0.8472
AT1G50660 unknown protein Lus10043111 3.5 0.8562
AT5G41610 ATCHX18 cation/H+ exchanger 18, ARABID... Lus10017541 4.5 0.8145
AT5G20510 Alfin AL5 alfin-like 5 (.1) Lus10015637 7.7 0.8457
AT4G27950 AP2_ERF CRF4 cytokinin response factor 4 (.... Lus10010129 8.9 0.8306
AT5G44280 ATRING1A ARABIDOPSIS THALIANA RING 1A, ... Lus10018609 10.6 0.8229
AT1G60200 splicing factor PWI domain-con... Lus10013003 13.1 0.7637
AT3G04670 WRKY ATWRKY39, WRKY3... WRKY DNA-binding protein 39 (.... Lus10033857 14.4 0.7994
AT1G73450 Protein kinase superfamily pro... Lus10031328 15.4 0.7759

Lus10026767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.