Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27130 81 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 72 / 2e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 67 / 8e-15 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 66 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 64 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 60 / 6e-12 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 60 / 9e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 56 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G36150 52 / 8e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 49 / 7e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008400 [exp] 211 / 1e-71 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026769 [exp] 159 / 2e-50 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10008401 [exp] 155 / 1e-48 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001153 [exp] 113 / 3e-32 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 69 / 3e-15 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 69 / 6e-15 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041197 [exp] 66 / 3e-14 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 66 / 6e-14 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 65 / 6e-14 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G158100 [exp] 85 / 3e-21 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 83 / 3e-20 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 75 / 1e-17 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 67 / 1e-14 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 66 / 4e-14 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 59 / 1e-11 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G169000 [exp] 57 / 1e-10 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050400 [exp] 53 / 4e-09 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 50 / 3e-08 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 48 / 1e-07 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10026768 pacid=23176576 polypeptide=Lus10026768 locus=Lus10026768.g ID=Lus10026768.BGIv1.0 annot-version=v1.0 ATGTCTCGCCATTACCCAACAACCACCCTCATCACCATCGCCGCCGTCATCGCCATCTCGGCCGCCGTCTCCTCCGCCCAGACGCCGACGATGGCTCCAA TGATCCCCGCCGGCGACTCTACTTCGCCGGCCCCATCTCCATCGGTGGACTGCTTAACCCAGCTACTGACGCTGTCAGACTGCTTGTCGTACGTTTTAAA AGACAGCAATGAGACCAAACCGGACAAGGCTTGCTGCCCGGAGCTGGCCGGCCTGGTAGGAAACTACCCAACTTGCCTTTGCACGCTCTTCACACTTAAC GCCTCGTCGTACGGACTGGAAGTTGACTATGGCAGAGCGTTTGGTCTCCCTTCCGCCTGCTCCGTCTCCGTTCCTCCCGGTGTTACCTCCTGCGCCCGCG GTAAAACACTTAATTAA
AA sequence Show only first row Show all	>Lus10026768 pacid=23176576 polypeptide=Lus10026768 locus=Lus10026768.g ID=Lus10026768.BGIv1.0 annot-version=v1.0 MSRHYPTTTLITIAAVIAISAAVSSAQTPTMAPMIPAGDSTSPAPSPSVDCLTQLLTLSDCLSYVLKDSNETKPDKACCPELAGLVGNYPTCLCTLFTLN ASSYGLEVDYGRAFGLPSACSVSVPPGVTSCARGKTLN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27130			Bifunctional inhibitor/lipid-t...		Lus10026768 [exp]	0	1
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10009184 [exp]	3.5	0.8757
AT5G07030			Eukaryotic aspartyl protease f...		Lus10026171 [exp]	5.5	0.8330
AT1G34110			Leucine-rich receptor-like pro...		Lus10017782 [exp]	8.1	0.8670
					Lus10032664 [exp]	8.9	0.8530
AT3G26744	bHLH	SCRM, ATICE1, I...	SCREAM, A. THALIANA INDUCER OF...		Lus10032542 [exp]	9.2	0.8844
AT5G28300	Trihelix		Duplicated homeodomain-like su...		Lus10015924 [exp]	11.1	0.8122
AT4G35160			O-methyltransferase family pro...		Lus10025098 [exp]	14.9	0.8602
AT4G34760			SAUR-like auxin-responsive pro...		Lus10007553 [exp]	17.4	0.8318
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10003343 [exp]	18.9	0.8665
AT5G23310		FSD3	Fe superoxide dismutase 3 (.1)		Lus10017378 [exp]	20.5	0.8647

Compare expression of checked genes

Lus10026768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.