Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43720 77 / 1e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G27130 75 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 67 / 3e-14 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 61 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 56 / 6e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G36150 56 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 54 / 3e-09 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G48130 50 / 1e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 49 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 46 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008401 [exp] 182 / 4e-58 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 140 / 1e-42 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008400 [exp] 134 / 2e-40 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001153 [exp] 111 / 1e-30 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 72 / 1e-15 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 64 / 9e-13 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 63 / 2e-12 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 61 / 2e-11 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039348 [exp] 60 / 2e-11 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G196000 [exp] 78 / 8e-18 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G158100 [exp] 76 / 4e-17 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 62 / 4e-12 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 61 / 7e-12 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 59 / 1e-10 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G210100 [exp] 54 / 3e-09 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G050400 [exp] 50 / 1e-07 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G169000 [exp] 48 / 9e-07 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G232000 [exp] 45 / 5e-06 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G092800 [exp] 44 / 2e-05 AT5G64080 84 / 3e-20 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10026769 pacid=23176530 polypeptide=Lus10026769 locus=Lus10026769.g ID=Lus10026769.BGIv1.0 annot-version=v1.0 ATGTCTCACCAGTACTACCCAACAACCACCCTCGTCATAATCGCCGCCGCCATCACCATATCGGCCGCCCAGACGATGACGATGGCTCCAAGCCCCTCCT TCGAGTCGCCTGCGCCAGCTCCTTCGGTGGACTGCGAGGCCCAGCTAATGAACCTATCAGACTGCTTGTCGTACGTGTTAGTTGGGAGCAAGGACGCCAA GCCGGACAAAGCTTGCTGCCCGGAGCTCGCCGGGCTGCTCGGAAGCTACCCGACCTGCCTATGTACGCTTCTGACAATTAACGCCTCCTCGTATGGACTG GAAATTGACTACGGCAGAGCGTTTGGTCTCCCTTCGTTATGCTCCTTCTCCGTTCCTCCTGCCGTTACCTCCTGCGCCGGCGAAGCTAATGTTCCGATTG GAGCTCCATCGCCAAGCCAAGGAGGAGGCGCGGCGGGACCAGGCAGCGGAGAAGGAGGGATGATGGCACCTTCACCTGCAAGCAATGAGACCACCGGCGG CGGTGGAGGATCAAGAGGTTCGAGCCATGGCTCACCAACGACGCCCGTTCCAAAACTTGCTACACAGTTGCTCTCTTTACTGGTGCTACCGTTGGTATTT GTTTGA
AA sequence Show only first row Show all	>Lus10026769 pacid=23176530 polypeptide=Lus10026769 locus=Lus10026769.g ID=Lus10026769.BGIv1.0 annot-version=v1.0 MSHQYYPTTTLVIIAAAITISAAQTMTMAPSPSFESPAPAPSVDCEAQLMNLSDCLSYVLVGSKDAKPDKACCPELAGLLGSYPTCLCTLLTINASSYGL EIDYGRAFGLPSLCSFSVPPAVTSCAGEANVPIGAPSPSQGGGAAGPGSGEGGMMAPSPASNETTGGGGGSRGSSHGSPTTPVPKLATQLLSLLVLPLVF V

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10026769 [exp]	0	1
AT2G38110		ATGPAT6, GPAT6	glycerol-3-phosphate acyltrans...		Lus10004835 [exp]	1.7	0.8786
AT1G79720			Eukaryotic aspartyl protease f...		Lus10041621 [exp]	4.5	0.8182
AT3G20820			Leucine-rich repeat (LRR) fami...		Lus10031824 [exp]	4.5	0.8172
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10018647 [exp]	4.7	0.8424
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015242 [exp]	7.1	0.8397
AT3G17130			Plant invertase/pectin methyle...		Lus10037791 [exp]	9.2	0.8132
AT1G61350			ARM repeat superfamily protein...		Lus10002598 [exp]	9.5	0.8132
AT5G11420			Protein of unknown function, D...		Lus10008080 [exp]	12.7	0.8110
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	14.1	0.8114
AT1G02000		GAE2	UDP-D-glucuronate 4-epimerase ...		Lus10027195 [exp]	14.7	0.7932

Compare expression of checked genes

Lus10026769 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.