Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006163 [exp] 192 / 9e-64 AT5G62280 59 / 2e-10 Protein of unknown function (DUF1442) (.1) Lus10041061 [exp] 158 / 2e-50 AT5G62280 55 / 6e-09 Protein of unknown function (DUF1442) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026776 pacid=23176551 polypeptide=Lus10026776 locus=Lus10026776.g ID=Lus10026776.BGIv1.0 annot-version=v1.0 ATGGAGGTTATGAGGATGCTTGATGTGAACCCAGTTGGATCAATGGTGGTGGGTCACAACCTGAATAAGCAAGGGAGGGGTAAAGGTTGTTCCTTTGGAG AGGTTTTGACCAGGAATATTAATCAGAACAATAGTAAGAAAAGAGGAGGAGTTGCTTCTTCTTTTGTGAGTTTGCCGATTGGGGTTGGGATGGAGTTGAC TAAGATTGGTTCTACTACCAAATTGCCTGCTGTTGGGGTTAGTAGGAAGTACAAGAGGTTTCATGTCACGTTTGAGAATTGA
AA sequence Show only first row Show all	>Lus10026776 pacid=23176551 polypeptide=Lus10026776 locus=Lus10026776.g ID=Lus10026776.BGIv1.0 annot-version=v1.0 MEVMRMLDVNPVGSMVVGHNLNKQGRGKGCSFGEVLTRNINQNNSKKRGGVASSFVSLPIGVGMELTKIGSTTKLPAVGVSRKYKRFHVTFEN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026776 [exp]	0	1
AT2G37240			Thioredoxin superfamily protei...		Lus10030907 [exp]	32.9	0.7475
AT3G23530			Cyclopropane-fatty-acyl-phosph...		Lus10023741 [exp]	77.0	0.7228
AT3G06510		SFR2, ATSFR2	SENSITIVE TO FREEZING 2, Glyco...		Lus10010837 [exp]	94.5	0.7133
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10039094 [exp]	98.4	0.7027
AT1G68470			Exostosin family protein (.1)		Lus10013701 [exp]	104.4	0.6697
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Lus10005762 [exp]	112.6	0.6913
					Lus10028110 [exp]	132.2	0.7003
AT5G49910		CPHSC70-2EATSHO...	HEAT SHOCK PROTEIN 70-7, chlor...		Lus10017566 [exp]	138.9	0.6695
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10004633 [exp]	141.0	0.6944
AT5G22900		ATCHX3	cation/H+ exchanger 3, ARABIDO...		Lus10009846 [exp]	155.4	0.6774

Compare expression of checked genes

Lus10026776 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.