Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12490 130 / 1e-39 ATCYS6, ATCYSB ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) AT2G40880 110 / 7e-33 ATCYSA, FL3-27 cystatin A (.1) AT5G12140 97 / 7e-28 ATCYS1 cystatin-1 (.1) AT5G05110 94 / 3e-25 Cystatin/monellin family protein (.1) AT5G47550 64 / 1e-14 Cystatin/monellin superfamily protein (.1) AT4G16500 49 / 1e-08 Cystatin/monellin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008702 [exp] 114 / 7e-33 AT3G12490 241 / 9e-81 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Lus10026117 [exp] 111 / 1e-31 AT3G12490 261 / 2e-88 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Lus10041257 [exp] 52 / 2e-09 AT2G31980 72 / 9e-17 PHYTOCYSTATIN 2 (.1) Lus10017567 [exp] 42 / 6e-06 AT5G47550 69 / 7e-16 Cystatin/monellin superfamily protein (.1) Lus10010495 [exp] 42 / 8e-06 AT5G47550 73 / 1e-17 Cystatin/monellin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G225800 [exp] 142 / 6e-46 AT3G12490 142 / 4e-44 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.009G022300 [exp] 138 / 3e-44 AT3G12490 134 / 4e-41 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.003G192200 [exp] 137 / 5e-42 AT3G12490 303 / 6e-105 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.001G032900 [exp] 131 / 4e-40 AT3G12490 276 / 2e-95 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.006G033201 [exp] 120 / 6e-36 AT3G12490 251 / 8e-86 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.016G030900 [exp] 119 / 4e-35 AT3G12490 244 / 5e-82 ARABIDOPSIS THALIANA PHYTOCYSTATIN 6, cystatin B (.1.2) Potri.006G014500 [exp] 49 / 1e-08 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1) Potri.002G235800 [exp] 46 / 1e-07 AT2G31980 96 / 5e-26 PHYTOCYSTATIN 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0121 [flax] [poplar] Cystatin PF00031 [flax] [poplar] Cystatin Cystatin domain
Representative CDS sequence Show only first row Show all	>Lus10026779 pacid=23176619 polypeptide=Lus10026779 locus=Lus10026779.g ID=Lus10026779.BGIv1.0 annot-version=v1.0 ATGGCGACAGTAGGCGGAGTTAAAGAAGTCCAAGGATCGACCAACAGCGTGGAGATCGACGAACTCGCTCGTTTCGCCGTCGATCATCATAACCAAAAAG AGAATGCGCTGCTGGAGTTCAACGGTGTTGTGGGGACAAAGCAGCAGGTGGTCGCTGGTACGATCCATCATATCACCTTGGAAGCCACTGACGGCGGAAA GAAGAAGACCTATGAAGCTAAGGTGTGGGTGAAGCCATGGATCAAATTCAAGGAGGTCCAGGCTTTTAAGCTTGTAGGCGATGCCTAA
AA sequence Show only first row Show all	>Lus10026779 pacid=23176619 polypeptide=Lus10026779 locus=Lus10026779.g ID=Lus10026779.BGIv1.0 annot-version=v1.0 MATVGGVKEVQGSTNSVEIDELARFAVDHHNQKENALLEFNGVVGTKQQVVAGTIHHITLEATDGGKKKTYEAKVWVKPWIKFKEVQAFKLVGDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G12490		ATCYS6, ATCYSB	ARABIDOPSIS THALIANA PHYTOCYST...		Lus10026779 [exp]	0	1
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10028349 [exp]	2.0	0.9400
					Lus10034389 [exp]	2.8	0.9332
AT2G41110		ACAM-2, ATCAL5,...	calmodulin 2 (.1.2)		Lus10021487 [exp]	8.2	0.9240
AT1G73040			Mannose-binding lectin superfa...		Lus10037605 [exp]	8.9	0.9176
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10024201 [exp]	9.0	0.9182
AT2G39440			unknown protein		Lus10018300 [exp]	9.5	0.9253
AT4G19510			Disease resistance protein (TI...		Lus10008209 [exp]	10.5	0.9171
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042468 [exp]	11.3	0.8928
AT5G04890		RTM2	RESTRICTED TEV MOVEMENT 2, HSP...		Lus10023624 [exp]	12.2	0.9221
AT5G39020			Malectin/receptor-like protein...		Lus10025545 [exp]	12.3	0.9192

Compare expression of checked genes

Lus10026779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.