Lus10026789 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07870 87 / 3e-20 F-box and associated interaction domains-containing protein (.1)
AT2G05600 41 / 0.0002 F-box associated ubiquitination effector family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036105 299 / 3e-101 AT3G07870 206 / 1e-61 F-box and associated interaction domains-containing protein (.1)
Lus10006403 91 / 5e-22 AT3G07870 362 / 2e-124 F-box and associated interaction domains-containing protein (.1)
Lus10012355 87 / 3e-20 AT3G07870 393 / 2e-135 F-box and associated interaction domains-containing protein (.1)
Lus10012358 69 / 1e-13 AT3G07870 181 / 3e-52 F-box and associated interaction domains-containing protein (.1)
Lus10032458 48 / 1e-06 AT4G12560 120 / 1e-30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G223000 100 / 4e-25 AT3G07870 467 / 5e-164 F-box and associated interaction domains-containing protein (.1)
Potri.014G162600 96 / 4e-23 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1)
Potri.013G053301 69 / 9e-14 AT3G07870 258 / 7e-83 F-box and associated interaction domains-containing protein (.1)
Potri.001G035500 52 / 4e-08 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.008G215901 51 / 9e-08 AT3G07870 103 / 3e-24 F-box and associated interaction domains-containing protein (.1)
Potri.008G215800 49 / 5e-07 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
Potri.011G037200 49 / 5e-07 AT3G07870 134 / 6e-35 F-box and associated interaction domains-containing protein (.1)
Potri.008G216223 49 / 6e-07 AT3G07870 93 / 4e-21 F-box and associated interaction domains-containing protein (.1)
Potri.011G037312 47 / 3e-06 AT3G07870 134 / 3e-35 F-box and associated interaction domains-containing protein (.1)
Potri.006G011400 46 / 6e-06 AT4G12560 142 / 2e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0162 FBA PF07734 FBA_1 F-box associated
Representative CDS sequence
>Lus10026789 pacid=23176533 polypeptide=Lus10026789 locus=Lus10026789.g ID=Lus10026789.BGIv1.0 annot-version=v1.0
ATGAATGATCATTACCATTACAAGGAGTTGCCCAAGCTGAATCTGCAGGTAAATTTGGATACAGTTTGCAGGGTGGTTTTTGGTTTTGGATTCCATCCAC
GGACAAAAGAGTACAAGGGTGTTAAAGTCGTGTATTACAAACTGTGGACCTATGACTTCTCTGGGGAGAACCCTGAAGCATTCGTGCTGACTATAGGCAA
AGACGATGACTGGAGGAAACTTGGGAAAATTTCCTACTCGTTGAATGGTCCAACATCTGAAGCACTAGTAGCTGGCAGGCTTCATTGGAGAAGTTACATT
GCTGAAGGAGAAGATGTTAGATCCAAGACGACCATTGTCTCATTCGACTTGGAAAATGAACATTTCCAGCCCATCCCTAGAATTGGTTACCCTTCTTCAA
GCCGGATGGATCACAATGTAGTTAACTTAGGAGGTTGTCTTTCTACAGCAGTGTTGAACGGCGATGGAACAACCGAGATTTGGGTGATGAAGTGCTACAA
CATGGAGGAATCTGTTTCTTTAAGTTCATGGAAGGGTGCTGTTTCTTTACAGGAGCAAATGCCTGGTTATTTATTATCCAGGTAG
AA sequence
>Lus10026789 pacid=23176533 polypeptide=Lus10026789 locus=Lus10026789.g ID=Lus10026789.BGIv1.0 annot-version=v1.0
MNDHYHYKELPKLNLQVNLDTVCRVVFGFGFHPRTKEYKGVKVVYYKLWTYDFSGENPEAFVLTIGKDDDWRKLGKISYSLNGPTSEALVAGRLHWRSYI
AEGEDVRSKTTIVSFDLENEHFQPIPRIGYPSSSRMDHNVVNLGGCLSTAVLNGDGTTEIWVMKCYNMEESVSLSSWKGAVSLQEQMPGYLLSR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07870 F-box and associated interacti... Lus10026789 0 1
Lus10012132 17.5 0.7871
Lus10010271 24.0 0.7653
AT3G07840 Pectin lyase-like superfamily ... Lus10011030 30.9 0.7501
AT5G01250 alpha 1,4-glycosyltransferase ... Lus10035526 44.0 0.7112
AT3G14770 SWEET2, AtSWEET... Nodulin MtN3 family protein (.... Lus10002600 52.5 0.7137
AT5G23540 Mov34/MPN/PAD-1 family protein... Lus10012494 57.4 0.7417
AT2G37890 Mitochondrial substrate carrie... Lus10036193 66.1 0.6920
Lus10000890 71.1 0.6953
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10027514 79.7 0.6980
AT2G21610 PE11, ATPE11 A. THALIANA PECTINESTERASE 11,... Lus10042315 94.8 0.6639

Lus10026789 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.