Lus10026794 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001462 60 / 8e-12 AT3G05700 124 / 5e-35 Drought-responsive family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026794 pacid=23176589 polypeptide=Lus10026794 locus=Lus10026794.g ID=Lus10026794.BGIv1.0 annot-version=v1.0
ATGATGAAAAGAGTACAGTCAACTTCTTCCTATACAATTGACTTCCAAGGGAGGCTCCCGAGTTGGAATTTCAGGTATGCCATTGTCCTGAAGGATGATG
ATGATGACGATGATGATAATGAGTTATCTCGATATTGTCGGTCTTCTGCTATTGTTTCCCGTACTGATGCGTTCCTATCATTCATACAAACGATGCCCAC
TCTCGCCAAAGCAGAAGATGCTCAACTCTACCCAAATAGATGCTGGAAAGGGAAAAGCCAAGAAGATAAGCAATGTGACAGTGTTGGTTCCCCATTCTCG
AGTCCCGATTCCCGGCAAGGAAGTGGCGTCCTTGCCGGGAGCAAATAA
AA sequence
>Lus10026794 pacid=23176589 polypeptide=Lus10026794 locus=Lus10026794.g ID=Lus10026794.BGIv1.0 annot-version=v1.0
MMKRVQSTSSYTIDFQGRLPSWNFRYAIVLKDDDDDDDDNELSRYCRSSAIVSRTDAFLSFIQTMPTLAKAEDAQLYPNRCWKGKSQEDKQCDSVGSPFS
SPDSRQGSGVLAGSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026794 0 1
AT5G44640 BGLU13 beta glucosidase 13 (.1) Lus10024065 1.4 0.8799
AT4G18160 KCO6, ATTPK3, A... Ca2+ activated outward rectify... Lus10004538 4.0 0.8030
Lus10007779 4.9 0.8087
Lus10002975 10.6 0.7772
AT1G26140 unknown protein Lus10034406 11.2 0.7554
AT5G03980 SGNH hydrolase-type esterase s... Lus10009325 12.1 0.8275
AT5G46090 Protein of unknown function (D... Lus10013933 12.3 0.8285
AT3G60160 ATMRP9, ABCC9 ATP-binding cassette C9, multi... Lus10022808 16.7 0.8154
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10035423 17.1 0.7225
AT3G25900 HMT-1, ATHMT-1 Homocysteine S-methyltransfera... Lus10034320 18.4 0.6929

Lus10026794 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.