Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036086 [exp] 36 / 0.0009 AT3G21760 431 / 2e-147 HYPOSTATIN RESISTANCE 1, UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026796 pacid=23176558 polypeptide=Lus10026796 locus=Lus10026796.g ID=Lus10026796.BGIv1.0 annot-version=v1.0 ATGGCGGAAGAGATAAGGATGAGTTACAGGGAGGAAAGTGGAGAGGTTGTTAAGGTGGAGGAGATTGAGAAAGGGATAATGAGGTTGATGAGTGAGGAGA GTGGTGGTGAGAGAAGGAAGAAAATGAAGGAGATGAGTGAAAAGAGCAGGAAGACCATGGGAAAGGGTGGAGCCTTCATACCACGCCATTAG
AA sequence Show only first row Show all	>Lus10026796 pacid=23176558 polypeptide=Lus10026796 locus=Lus10026796.g ID=Lus10026796.BGIv1.0 annot-version=v1.0 MAEEIRMSYREESGEVVKVEEIEKGIMRLMSEESGGERRKKMKEMSEKSRKTMGKGGAFIPRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026796 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002392 [exp]	2.4	0.8597
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002398 [exp]	2.4	0.8605
AT3G12620			Protein phosphatase 2C family ...		Lus10003993 [exp]	3.0	0.8655
AT1G80600		WIN1	HOPW1-1-interacting 1 (.1)		Lus10031775 [exp]	5.1	0.8356
AT3G55050			Protein phosphatase 2C family ...		Lus10015047 [exp]	5.7	0.8585
AT2G38870			Serine protease inhibitor, pot...		Lus10014740 [exp]	7.4	0.8583
AT5G45340		CYP707A3	"cytochrome P450, family 707, ...		Lus10034768 [exp]	10.1	0.8196
AT1G27040			Major facilitator superfamily ...		Lus10002793 [exp]	11.2	0.8580
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014402 [exp]	12.4	0.8438
					Lus10015218 [exp]	12.6	0.8546

Compare expression of checked genes

Lus10026796 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.