Lus10026804 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026804 pacid=23176539 polypeptide=Lus10026804 locus=Lus10026804.g ID=Lus10026804.BGIv1.0 annot-version=v1.0
ATGCCTGGCTGGGCTTCACGGTGGTCGGAATCTGACGCCGGCCTGATGATATATCTGCCCGGAATTTCGCCCGGACAGACCAAAAATTACTGTATTTTAA
AGAAAAATTTTCCGAATACTAGTGGCGCTAAAGCTGCTGAGTGCTCCTTTCTTCATTTCAGGTGTGCGTCGCTCCTTTTCTTCACATCCAACGCCAGAGA
CTTTCTGAACCCTAATTTCCCAGTTCCGACTAACTGCTCCATCGAACCCTCCAAGTTTGAAGTTTTATGTCTAACTACGCAGTTCGCACCCTTACCAGGT
AGAGCTTCCAGCAACTGCGTGGCGGAAATGGCAGTGTTCCATTTGGACTCCGACTCCTACTTTCTCAACACCAACCCTGATGACAGTAAGGTTTATGTGA
ACAAGAATATGGGGTTTGAGAATTGGGAGTACTTGACTTGTATAGGGAATGGTGAAAAGTACACAGAACTGCAAGTTTCAGGAGTGGTCATCCGAGGCCA
CAAGCTGCACGAATTGGCTGTTGACTTGAGACCCATTATGTTCTAA
AA sequence
>Lus10026804 pacid=23176539 polypeptide=Lus10026804 locus=Lus10026804.g ID=Lus10026804.BGIv1.0 annot-version=v1.0
MPGWASRWSESDAGLMIYLPGISPGQTKNYCILKKNFPNTSGAKAAECSFLHFRCASLLFFTSNARDFLNPNFPVPTNCSIEPSKFEVLCLTTQFAPLPG
RASSNCVAEMAVFHLDSDSYFLNTNPDDSKVYVNKNMGFENWEYLTCIGNGEKYTELQVSGVVIRGHKLHELAVDLRPIMF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026804 0 1
AT1G80770 PDE318 pigment defective 318, P-loop ... Lus10043354 12.4 0.7288
AT4G35520 MLH3, ATMLH3 MUTL protein homolog 3 (.1) Lus10035985 29.4 0.6902
AT5G61930 APO3 ACCUMULATION OF PHOTOSYSTEM ON... Lus10005547 60.9 0.6464
AT4G35290 ATGLUR2, ATGLR3... GLUTAMATE RECEPTOR 3.2, glutam... Lus10013837 72.4 0.5734
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10022866 98.0 0.6296
AT1G17980 PAPS1 poly(A) polymerase 1 (.1), pol... Lus10009641 109.5 0.5633
AT2G26540 ATUROS, ATDUF3,... ARABIDOPSIS THALIANA UROPORPHY... Lus10021755 197.1 0.5593
AT5G63100 S-adenosyl-L-methionine-depend... Lus10015621 245.9 0.5650
AT5G19460 ATNUDT20 nudix hydrolase homolog 20 (.1... Lus10033086 247.3 0.5505
Lus10040651 257.5 0.5536

Lus10026804 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.