Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62890 64 / 5e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G13600 64 / 7e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G03880 63 / 2e-13 REME1 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G29760 62 / 3e-13 OTP81 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G61170 61 / 9e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49142 61 / 1e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G15510 61 / 1e-12 VAC1, ATECB2 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G18750 59 / 3e-12 DOT4 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G63370 59 / 4e-12 OTP86 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G39530 59 / 4e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036071 [exp] 124 / 6e-35 AT1G18485 464 / 5e-151 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10024936 [exp] 69 / 2e-15 AT3G61170 855 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022890 [exp] 68 / 3e-15 AT3G61170 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10020081 [exp] 66 / 2e-14 AT3G49710 886 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010320 [exp] 65 / 5e-14 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10041097 [exp] 61 / 1e-12 AT5G66520 367 / 2e-119 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039117 [exp] 61 / 1e-12 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015898 [exp] 61 / 1e-12 AT2G13600 899 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10019731 [exp] 61 / 1e-12 AT2G13600 436 / 3e-143 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G067000 [exp] 84 / 5e-21 AT1G18485 500 / 8e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G058700 [exp] 63 / 1e-13 AT1G15510 1113 / 0.0 VANILLA CREAM 1, ARABIDOPSIS EARLY CHLOROPLAST BIOGENESIS2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G012500 [exp] 62 / 3e-13 AT3G49710 995 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G067500 [exp] 62 / 3e-13 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G208000 [exp] 62 / 4e-13 AT2G03880 939 / 0.0 required for efficiency of mitochondrial editing 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G155100 [exp] 62 / 4e-13 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G168800 [exp] 61 / 9e-13 AT2G02980 860 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G027800 [exp] 61 / 1e-12 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.018G152300 [exp] 61 / 1e-12 AT4G33990 489 / 1e-162 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G104700 [exp] 61 / 1e-12 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026811 pacid=23176605 polypeptide=Lus10026811 locus=Lus10026811.g ID=Lus10026811.BGIv1.0 annot-version=v1.0 ATGCTATCAAACATATATGCGGAAGTGGGCAAATGGGAGGAGGCAGATTTGGTAAGGAAACTGATGAAAGTAAAGGGTGCAACTAAAACTCCTGGCTGCA GTTGGGTTCACACCAACGGCCAGGTTCATGCCTTCATAGCGGGAGACAGACTACAATTAGTTGATTCATACAATTGGGGCGCTGAGGCTTGA
AA sequence Show only first row Show all	>Lus10026811 pacid=23176605 polypeptide=Lus10026811 locus=Lus10026811.g ID=Lus10026811.BGIv1.0 annot-version=v1.0 MLSNIYAEVGKWEEADLVRKLMKVKGATKTPGCSWVHTNGQVHAFIAGDRLQLVDSYNWGAEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10026811 [exp]	0	1
AT4G21120		CAT1, AAT1	CATIONIC AMINO ACID TRANSPORTE...		Lus10003697 [exp]	1.0	0.9824
AT3G14570		ATGSL4, ATGSL04	glucan synthase-like 4 (.1.2)		Lus10026188 [exp]	2.4	0.9812
					Lus10017955 [exp]	2.8	0.9816
					Lus10008289 [exp]	4.9	0.9676
					Lus10036765 [exp]	5.7	0.9790
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	6.3	0.9790
AT2G16190			unknown protein		Lus10011284 [exp]	6.9	0.9790
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	7.3	0.9542
AT3G54200			Late embryogenesis abundant (L...		Lus10031554 [exp]	7.5	0.9790
AT1G63740			Disease resistance protein (TI...		Lus10007834 [exp]	7.5	0.9520

Compare expression of checked genes

Lus10026811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.