Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12190 225 / 8e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G08695 53 / 6e-09 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G30260 50 / 2e-08 U2B'' U2 small nuclear ribonucleoprotein B (.1) AT1G49760 49 / 1e-07 PABP8, PAB8 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) AT2G35410 49 / 1e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G02430 48 / 1e-07 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G06960 47 / 3e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G02840 47 / 4e-07 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT1G60000 47 / 5e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT4G19610 46 / 1e-06 nucleotide binding;nucleic acid binding;RNA binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026815 [exp] 218 / 8e-75 AT5G12190 192 / 9e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10027733 [exp] 48 / 2e-07 AT2G36660 569 / 0.0 poly(A) binding protein 7 (.1) Lus10016174 [exp] 47 / 6e-07 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) Lus10007869 [exp] 46 / 1e-06 AT1G02840 308 / 1e-105 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10020656 [exp] 45 / 4e-06 AT1G02840 297 / 2e-100 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10029885 [exp] 45 / 4e-06 AT1G02840 253 / 2e-81 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Lus10026413 [exp] 45 / 4e-06 AT2G30260 350 / 1e-123 U2 small nuclear ribonucleoprotein B (.1) Lus10042240 [exp] 44 / 4e-06 AT2G30260 352 / 2e-124 U2 small nuclear ribonucleoprotein B (.1) Lus10002835 [exp] 44 / 5e-06 AT4G34110 918 / 0.0 ARABIDOPSIS POLY\(A\) BINDING 2, poly(A) binding protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G067500 [exp] 236 / 3e-82 AT5G12190 226 / 4e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G273200 [exp] 234 / 2e-81 AT5G12190 227 / 1e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G024600 [exp] 52 / 1e-08 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.019G121400 [exp] 49 / 1e-07 AT2G30260 305 / 7e-106 U2 small nuclear ribonucleoprotein B (.1) Potri.006G190900 [exp] 48 / 2e-07 AT3G15010 179 / 6e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.013G153700 [exp] 47 / 6e-07 AT2G30260 297 / 8e-103 U2 small nuclear ribonucleoprotein B (.1) Potri.002G124200 [exp] 46 / 1e-06 AT1G49760 822 / 0.0 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) Potri.002G214000 [exp] 45 / 2e-06 AT4G03110 506 / 4e-179 RNA-binding protein-defense related 1 (.1.2) Potri.016G048100 [exp] 45 / 2e-06 AT3G15010 181 / 1e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.014G025400 [exp] 45 / 2e-06 AT1G49760 789 / 0.0 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10026814 pacid=23176620 polypeptide=Lus10026814 locus=Lus10026814.g ID=Lus10026814.BGIv1.0 annot-version=v1.0 ATGTCGGTTAGCCTTCGCAAGGGAAACACCCGCCTACCGCCGGAGGTGAACCGGGTGCTCTACGTCCGTAACCTCCCCTTCAACATCTCCAGCGAGGAGA TGTATGATATCTTCGGCAAGTTCGGAGCGATTCGCCAGATCCGAGTCGGCAACGGCAAGGACACCAGAGGCACAGCTTTCGTGGTCTACGAGGACATCTA CGACGCCAAGACGGCCGTGGACCACCTCTCCGGCTTCAACGTCGCCAACAGGTACCTCATCGTTCTGTATTACCAGCAGGCGAAGATGAGTAAGAAGTTC GACCAGAAGAAGAAGGAAGACGAGCTTGTTAAGATGCAGGAGAAATACGGAGTCTCCACTAAAGATAAGTAG
AA sequence Show only first row Show all	>Lus10026814 pacid=23176620 polypeptide=Lus10026814 locus=Lus10026814.g ID=Lus10026814.BGIv1.0 annot-version=v1.0 MSVSLRKGNTRLPPEVNRVLYVRNLPFNISSEEMYDIFGKFGAIRQIRVGNGKDTRGTAFVVYEDIYDAKTAVDHLSGFNVANRYLIVLYYQQAKMSKKF DQKKKEDELVKMQEKYGVSTKDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Lus10026814 [exp]	0	1
AT5G67490			unknown protein		Lus10019019 [exp]	3.6	0.7896
AT1G27310		NTF2A	nuclear transport factor 2A (....		Lus10035202 [exp]	3.7	0.8658
AT3G48610		NPC6	non-specific phospholipase C6 ...		Lus10025726 [exp]	5.8	0.8387
AT4G37090			unknown protein		Lus10019656 [exp]	8.4	0.7960
AT5G11770			NADH-ubiquinone oxidoreductase...		Lus10039485 [exp]	10.4	0.8114
AT1G15710			prephenate dehydrogenase famil...		Lus10023121 [exp]	13.2	0.8307
AT1G77360			Tetratricopeptide repeat (TPR)...		Lus10017633 [exp]	13.4	0.8046
AT1G06270			Pentatricopeptide repeat (PPR)...		Lus10017675 [exp]	14.3	0.7930
AT4G12340			copper ion binding (.1)		Lus10032225 [exp]	15.5	0.8013
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10025890 [exp]	15.8	0.7700

Compare expression of checked genes

Lus10026814 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.