Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12190 150 / 4e-48 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G14870 72 / 1e-17 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026814 [exp] 177 / 2e-58 AT5G12190 225 / 8e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10018277 [exp] 38 / 0.0009 AT4G19610 770 / 0.0 nucleotide binding;nucleic acid binding;RNA binding (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G067500 [exp] 161 / 2e-52 AT5G12190 226 / 4e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G273200 [exp] 159 / 8e-52 AT5G12190 227 / 1e-78 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10026815 pacid=23176614 polypeptide=Lus10026815 locus=Lus10026815.g ID=Lus10026815.BGIv1.0 annot-version=v1.0 ATGTCGGTCAGCCTTCGCAAGGGAAACGCCCGCCTTCCGCCGAACGTGAACCGCGTCGTCTACGTCCGTAACCTCCCCTACAACATCTCCAGCGAGGAGA TGTACGATATCTTCGGCAAGTTCGGAGCGATTCGCCAGATCCGAGACGGCAACGGCAAGGACACCAGAGGCACAGCTCTAGTGGTCTACGAGGACATCTA CGATGCCAAGACGGCCGTGGATCACCTCTCTGACTTCAACGTCGCCGGCAGGTACCTGGTACTTACGTATTACCAACAGGGCAGGATGAGCAAGAATTTG TACCAGAAGAAGCAGGAAGACGAGCTTGTTAAGATGCAGGAGAAATACGGAGTCTCTGCTAAAGATAAGTAG
AA sequence Show only first row Show all	>Lus10026815 pacid=23176614 polypeptide=Lus10026815 locus=Lus10026815.g ID=Lus10026815.BGIv1.0 annot-version=v1.0 MSVSLRKGNARLPPNVNRVVYVRNLPYNISSEEMYDIFGKFGAIRQIRDGNGKDTRGTALVVYEDIYDAKTAVDHLSDFNVAGRYLVLTYYQQGRMSKNL YQKKQEDELVKMQEKYGVSAKDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Lus10026815 [exp]	0	1
AT2G47230		ATDUF6	DOMAIN OF UNKNOWN FUNCTION 724...		Lus10004508 [exp]	1.7	0.8868
AT5G24650			Mitochondrial import inner mem...		Lus10032959 [exp]	2.8	0.8360
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Lus10039715 [exp]	6.3	0.8288
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10027507 [exp]	7.2	0.8191
AT5G14370			CCT motif family protein (.1)		Lus10014886 [exp]	7.7	0.8444
AT5G27270		EMB976	EMBRYO DEFECTIVE 976, Tetratri...		Lus10003465 [exp]	8.1	0.8601
AT4G04720		CPK21	calcium-dependent protein kina...		Lus10020046 [exp]	8.9	0.8393
					Lus10008149 [exp]	9.2	0.8182
AT5G08520	MYB		Duplicated homeodomain-like su...		Lus10013447 [exp]	10.1	0.8390
AT5G14370			CCT motif family protein (.1)		Lus10022311 [exp]	13.9	0.8196

Compare expression of checked genes

Lus10026815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.