Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G46264 70 / 4e-15 HSF SCZ, AT-HSFB4 SCHIZORIZA, heat shock transcription factor B4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036062 [exp] 145 / 1e-43 AT1G46264 245 / 3e-79 SCHIZORIZA, heat shock transcription factor B4 (.1) Lus10042646 [exp] 67 / 6e-14 AT1G46264 308 / 8e-103 SCHIZORIZA, heat shock transcription factor B4 (.1) Lus10001133 [exp] 67 / 7e-14 AT1G46264 319 / 4e-107 SCHIZORIZA, heat shock transcription factor B4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G273700 [exp] 82 / 5e-20 AT1G46264 251 / 2e-82 SCHIZORIZA, heat shock transcription factor B4 (.1) Potri.009G068000 [exp] 74 / 9e-17 AT1G46264 258 / 4e-85 SCHIZORIZA, heat shock transcription factor B4 (.1) Potri.002G124800 [exp] 68 / 2e-14 AT1G46264 353 / 7e-121 SCHIZORIZA, heat shock transcription factor B4 (.1) Potri.014G027100 [exp] 68 / 2e-14 AT1G46264 335 / 9e-114 SCHIZORIZA, heat shock transcription factor B4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026820 pacid=23176541 polypeptide=Lus10026820 locus=Lus10026819.g ID=Lus10026820.BGIv1.0 annot-version=v1.0 ATGATGTTGAGGGCACTTTCGGAGGATAACCAGCGGCTGAAGAAGAGGAACTTGGCTCTGCTCTCTGAGCTCTCCCACATGAAGTCATTGTACAACGACA TCATCTACTTCATCCAAAACCATCTCAAGCCTCACCACTGTTTTCCTTATCATCATCATCATCCCCCTACTACCACTACCACTACTAATAATAATAATAA CAAGCTCGTGGAACTGCAGAGTGATACTAAGGAGGATGACAGGGACGGTGGGGGCTGCACTGGTGGGGTAAAGCTGTTTGGGGTGTCGCTTTGTGGGAAG AAGAGGCAACTCCATTCTGATCATCATTATTTCACTGCTCTTTGTCCTCTTTCATCCTCCTCTTCCTTATGA
AA sequence Show only first row Show all	>Lus10026820 pacid=23176541 polypeptide=Lus10026820 locus=Lus10026819.g ID=Lus10026820.BGIv1.0 annot-version=v1.0 MMLRALSEDNQRLKKRNLALLSELSHMKSLYNDIIYFIQNHLKPHHCFPYHHHHPPTTTTTTNNNNNKLVELQSDTKEDDRDGGGCTGGVKLFGVSLCGK KRQLHSDHHYFTALCPLSSSSSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Lus10026820 [exp]	0	1
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Lus10026819 [exp]	1.7	0.8476
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	4.7	0.8672
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10024770 [exp]	5.5	0.8623
AT1G07290		GONST2	golgi nucleotide sugar transpo...		Lus10005865 [exp]	12.5	0.8426
AT4G13620	AP2_ERF		Integrase-type DNA-binding sup...		Lus10016669 [exp]	19.0	0.8247
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Lus10014724 [exp]	21.8	0.7603
AT4G01470		ATTIP1.3, GAMMA...	tonoplast intrinsic protein 1;...		Lus10005885 [exp]	24.1	0.8215
AT2G15730			P-loop containing nucleoside t...		Lus10021749 [exp]	27.4	0.8101
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10001912 [exp]	31.5	0.8223
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10009138 [exp]	35.0	0.8167

Compare expression of checked genes

Lus10026820 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.