Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12240 38 / 0.0002 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036054 [exp] 113 / 8e-34 AT5G12240 79 / 5e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G069000 [exp] 62 / 3e-13 AT5G12240 74 / 5e-18 unknown protein Potri.001G274400 [exp] 56 / 4e-11 AT5G12240 102 / 3e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026824 pacid=23176630 polypeptide=Lus10026824 locus=Lus10026824.g ID=Lus10026824.BGIv1.0 annot-version=v1.0 ATGGATGAAGAGGAATTCCGCCGCCACCTTGAACTCTTTCCTGTCTTCCGTTCCCCAGATTATCATATTGATTCAGACCCATCCAGGCAGTCGAATTCTT TAAGGCGCCCACAGCCCATTGAGAAGGGCAGGGAATTGCAGGGTGCTCGGGTGGAGCAAGGAGATGAACTGGAATTAGAGGATCAAGCTTTTGATACTCG TGATCCTTTCTGGGAGAAGCTCAAGTTGGCTGCAGAAAAGAAGGTATTGTTTCTGGATGTCTTATCATCATTAAGAATCATTGTGAGTCCATTTCTTCTG TGGCATCATACATCCAAGACTGTACACTAG
AA sequence Show only first row Show all	>Lus10026824 pacid=23176630 polypeptide=Lus10026824 locus=Lus10026824.g ID=Lus10026824.BGIv1.0 annot-version=v1.0 MDEEEFRRHLELFPVFRSPDYHIDSDPSRQSNSLRRPQPIEKGRELQGARVEQGDELELEDQAFDTRDPFWEKLKLAAEKKVLFLDVLSSLRIIVSPFLL WHHTSKTVH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12240			unknown protein		Lus10026824 [exp]	0	1
AT3G05000			Transport protein particle (TR...		Lus10033832 [exp]	1.0	0.9107
AT1G09920			TRAF-type zinc finger-related ...		Lus10028213 [exp]	2.2	0.8879
AT2G25310			Protein of unknown function (D...		Lus10001955 [exp]	3.5	0.8970
AT5G27830			unknown protein		Lus10020660 [exp]	3.9	0.8961
AT5G54590		CRLK1	calcium/calmodulin-regulated r...		Lus10043083 [exp]	4.1	0.8594
AT5G59460			scarecrow-like transcription f...		Lus10004969 [exp]	4.5	0.8947
AT1G12390			Cornichon family protein (.1)		Lus10015866 [exp]	4.9	0.8681
AT4G22330		ATCES1	Alkaline phytoceramidase (aPHC...		Lus10032606 [exp]	5.0	0.8530
AT2G45330		TRPT, EMB1067	2' tRNA phosphotransferase, em...		Lus10009289 [exp]	5.2	0.8491
AT5G51510			unknown protein		Lus10027200 [exp]	5.5	0.8839

Compare expression of checked genes

Lus10026824 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.