Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12910 102 / 9e-27 SCPL20 serine carboxypeptidase-like 20 (.1) AT3G25420 84 / 4e-20 SCPL21 serine carboxypeptidase-like 21 (.1) AT1G73290 44 / 7e-06 SCPL5 serine carboxypeptidase-like 5 (.1) AT3G12220 42 / 2e-05 SCPL16 serine carboxypeptidase-like 16 (.1) AT1G73310 42 / 3e-05 SCPL4 serine carboxypeptidase-like 4 (.1) AT5G09640 42 / 4e-05 SNG2, SCPL19 SINAPOYLGLUCOSE ACCUMULATOR 2, serine carboxypeptidase-like 19 (.1) AT1G73270 41 / 8e-05 SCPL6 serine carboxypeptidase-like 6 (.1) AT1G73280 41 / 8e-05 SCPL3 serine carboxypeptidase-like 3 (.1) AT2G22960 39 / 0.0003 alpha/beta-Hydrolases superfamily protein (.1) AT2G22920 39 / 0.0003 SCPL12 serine carboxypeptidase-like 12 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020206 [exp] 192 / 4e-60 AT4G12910 603 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10038240 [exp] 117 / 7e-32 AT4G12910 689 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10025859 [exp] 108 / 9e-29 AT4G12910 694 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10009562 [exp] 102 / 2e-26 AT4G12910 617 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10020387 [exp] 100 / 1e-25 AT4G12910 627 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10026830 [exp] 87 / 4e-21 AT4G12910 595 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10020207 [exp] 83 / 1e-19 AT4G12910 553 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10026831 [exp] 82 / 4e-19 AT4G12910 596 / 0.0 serine carboxypeptidase-like 20 (.1) Lus10010895 [exp] 41 / 5e-05 AT1G73280 444 / 6e-154 serine carboxypeptidase-like 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G177500 [exp] 110 / 1e-29 AT4G12910 743 / 0.0 serine carboxypeptidase-like 20 (.1) Potri.019G054300 [exp] 95 / 8e-24 AT4G12910 636 / 0.0 serine carboxypeptidase-like 20 (.1) Potri.008G041800 [exp] 38 / 0.0008 AT3G07990 736 / 0.0 serine carboxypeptidase-like 27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0028 [flax] [poplar] AB_hydrolase PF00450 [flax] [poplar] Peptidase_S10 Serine carboxypeptidase
Representative CDS sequence Show only first row Show all	>Lus10026827 pacid=23142917 polypeptide=Lus10026827 locus=Lus10026827.g ID=Lus10026827.BGIv1.0 annot-version=v1.0 ATGTTCGGTCGAGCTTGGCCGTTTCGTTCGCCTGTCCTCGATGGCATTGTTCGTCTCTGGTCTCAACTCTCCACCACCACCAACTCCGTTCCTTGCACGA GTGATGAAGTCGCCACCGCGTGGCTCAACAATGCAGCGGTCAGGAAAGCTCTGCTTGTTCCCCTGGATGTGGAGGAGTATCCATGGAATGTATGTGTTGG GAGATGGAATCTTCTCTACACACATGATCCTGGGAGTATGATCCCTTACCACAAGAATCTCACTTCCCTCGGCTATCGAGCTCTTATCTACAGGTTTCAT TCATTTCATTTCATCTCCTTTTCTATATTAATGTTTGGATATCATACCGAGTGA
AA sequence Show only first row Show all	>Lus10026827 pacid=23142917 polypeptide=Lus10026827 locus=Lus10026827.g ID=Lus10026827.BGIv1.0 annot-version=v1.0 MFGRAWPFRSPVLDGIVRLWSQLSTTTNSVPCTSDEVATAWLNNAAVRKALLVPLDVEEYPWNVCVGRWNLLYTHDPGSMIPYHKNLTSLGYRALIYRFH SFHFISFSILMFGYHTE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Lus10026827 [exp]	0	1
AT1G58360		NAT2, AAP1	NEUTRAL AMINO ACID TRANSPORTER...		Lus10033759 [exp]	10.5	0.7540
AT2G30580		BMI1A, DRIP2	DREB2A-interacting protein 2 (...		Lus10021993 [exp]	13.3	0.7755
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10039713 [exp]	13.9	0.7804
AT5G41020	MYB		myb family transcription facto...		Lus10022932 [exp]	19.3	0.7751
					Lus10040023 [exp]	24.5	0.7693
AT5G10520		RBK1	ROP binding protein kinases 1 ...		Lus10002659 [exp]	25.0	0.7723
AT1G17960			Threonyl-tRNA synthetase (.1)		Lus10030644 [exp]	29.1	0.7743
AT3G51150			ATP binding microtubule motor ...		Lus10015448 [exp]	33.2	0.6875
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10001914 [exp]	44.7	0.7637
AT4G31370		FLA5	FASCICLIN-like arabinogalactan...		Lus10026223 [exp]	47.1	0.7345

Compare expression of checked genes

Lus10026827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.