Lus10026839 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02790 142 / 3e-45 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
AT5G16470 138 / 2e-43 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020216 210 / 2e-71 AT3G02790 146 / 1e-46 zinc finger (C2H2 type) family protein (.1)
Lus10041105 164 / 1e-53 AT3G02790 153 / 1e-49 zinc finger (C2H2 type) family protein (.1)
Lus10036432 163 / 3e-53 AT3G02790 150 / 9e-49 zinc finger (C2H2 type) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G053500 153 / 4e-49 AT3G02790 160 / 2e-52 zinc finger (C2H2 type) family protein (.1)
Potri.013G086400 148 / 2e-47 AT3G02790 162 / 1e-53 zinc finger (C2H2 type) family protein (.1)
PFAM info
Representative CDS sequence
>Lus10026839 pacid=23142856 polypeptide=Lus10026839 locus=Lus10026839.g ID=Lus10026839.BGIv1.0 annot-version=v1.0
ATGACAGGAAAGGCGAAGCCGAAGAAGCACACGGCGAAGGAGATAGCGGCCAAGGTCGACGCCGCCACCACGAACAGAGGCGGAGGCAAAGCCGGATTAG
TTGACAGGACCGGCCTAACCAAAGGAGGCCATGCCAAATTCGAGTGCCCTCTCTGCAAGGTCACTGCTCCCGATATCAAATCCATGAAGATCCATCACGA
AGCTCGCCACCCTAAGCTCCCATTCGAGGAAGACAAGATCGTCAATCTCCACGCTTCTACCGCTGTCGCCACCGCTGCCCCCTCCGCTCCTGCTGCTGCT
GCTCCTGATACCTCTGGAAAGCCCCGCCCTGGAATCACTGCTGCTGCTGCTGATACCTCCGGCAAGCCACGTCCTGGAATCAGGGGAAGCTTGAAGAAGT
GA
AA sequence
>Lus10026839 pacid=23142856 polypeptide=Lus10026839 locus=Lus10026839.g ID=Lus10026839.BGIv1.0 annot-version=v1.0
MTGKAKPKKHTAKEIAAKVDAATTNRGGGKAGLVDRTGLTKGGHAKFECPLCKVTAPDIKSMKIHHEARHPKLPFEEDKIVNLHASTAVATAAPSAPAAA
APDTSGKPRPGITAAAADTSGKPRPGIRGSLKK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10026839 0 1
AT3G02790 C2H2ZnF zinc finger (C2H2 type) family... Lus10020216 1.4 0.9150
AT5G13890 Family of unknown function (DU... Lus10041505 4.5 0.8719
AT1G11360 Adenine nucleotide alpha hydro... Lus10037867 6.2 0.8881
AT1G27310 NTF2A nuclear transport factor 2A (.... Lus10015772 8.8 0.8339
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10017425 11.1 0.8813
AT1G29790 S-adenosyl-L-methionine-depend... Lus10025384 12.0 0.8717
AT3G22590 PHP, CDC73 PLANT HOMOLOGOUS TO PARAFIBROM... Lus10041198 12.6 0.8467
AT2G26110 Protein of unknown function (D... Lus10024988 12.8 0.8458
AT1G65270 unknown protein Lus10020224 13.2 0.8261
AT4G36020 CSDP1 cold shock domain protein 1 (.... Lus10028449 13.9 0.8272

Lus10026839 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.