Lus10026842 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G47840 174 / 5e-55 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
AT5G55710 99 / 1e-25 AtTic20-V translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020219 283 / 3e-97 AT2G47840 222 / 1e-73 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Lus10031203 105 / 4e-28 AT5G55710 263 / 3e-90 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Lus10031781 105 / 5e-28 AT5G55710 267 / 1e-91 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G084900 191 / 2e-61 AT2G47840 196 / 2e-63 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Potri.004G191700 110 / 6e-30 AT5G55710 228 / 2e-76 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
PFAM info
Representative CDS sequence
>Lus10026842 pacid=23142795 polypeptide=Lus10026842 locus=Lus10026842.g ID=Lus10026842.BGIv1.0 annot-version=v1.0
ATGGCGGCCACTACTTCCCTGCTCCGATTCTCCCCATCATCATCATCTAAAACCCTAATTCCATCTCCAAACCCCATCCATTACTCCTCCTCCACTTCCT
TCTCCCCTCTTCTCCCATCCTCCCCCAGCGGCTTCCTCCCCAATCTCCGTCTCTCTCAACGAAGGCCAATCACCATCGCCGCCCGCCTCTCCGGCAACAA
CAACGCCACCACGCCCGCCACCGATCGGTTAATCTCAGCCCTAGCCTACACTCTCCCATTCTTCAACTCCCTCCAGTACGGCCGCTTCCTCTTCGCCCAA
TTCCCTTCAATATCGGCTGTCGTCTTCGAGCCCATCCTCCCTTTGCTCTCCCTCTACCGCTCCCTTCCTTACGCGAGCTTCGTCGCCTTCTTCGGCATCT
ACCTTGGGATTGTGAGGAACAGCTATTTCAGCGACTATGCCAGGTTCAACGCGATGCAAGCGTTGACCCTGGACGTGCTTCTGGTGCTTCCTTTGCTGTT
CGGCAGGATTTTCAGCCTCGGTCGGAGCGGGCTGGGTTTGAAGCTGATTATTTGGGGTCATAATGGTGTGTTCTTCTTTACCTGCCTCTGCTTCGCTTAT
GGGTTGGTGAGCAGTGTTCTGGGGAAAACCCCTTATCTCCCTTTTGTTGCTGATGCGGCCCGTAGGCAAATGTAG
AA sequence
>Lus10026842 pacid=23142795 polypeptide=Lus10026842 locus=Lus10026842.g ID=Lus10026842.BGIv1.0 annot-version=v1.0
MAATTSLLRFSPSSSSKTLIPSPNPIHYSSSTSFSPLLPSSPSGFLPNLRLSQRRPITIAARLSGNNNATTPATDRLISALAYTLPFFNSLQYGRFLFAQ
FPSISAVVFEPILPLLSLYRSLPYASFVAFFGIYLGIVRNSYFSDYARFNAMQALTLDVLLVLPLLFGRIFSLGRSGLGLKLIIWGHNGVFFFTCLCFAY
GLVSSVLGKTPYLPFVADAARRQM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G47840 AtTic20-II translocon at the inner envelo... Lus10026842 0 1
AT2G47840 AtTic20-II translocon at the inner envelo... Lus10020219 1.0 0.9212
AT4G26500 SUFE1, EMB1374,... SULFUR E 1, MBRYO DEFECTIVE 13... Lus10032905 2.0 0.8740
AT2G37410 ATTIM17-2 TRANSLOCASE OF THE INNER MEMBR... Lus10011128 3.9 0.8727
AT3G06200 P-loop containing nucleoside t... Lus10041236 5.1 0.8340
AT2G31670 Stress responsive alpha-beta b... Lus10017873 8.2 0.8796
AT1G55890 Tetratricopeptide repeat (TPR)... Lus10020073 8.8 0.8696
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10006020 9.0 0.8745
AT2G17265 DMR1, HSK DOWNY MILDEW RESISTANT 1, homo... Lus10001387 10.6 0.8585
AT4G28730 GrxC5 glutaredoxin C5, Glutaredoxin ... Lus10011915 14.1 0.8432
AT5G44170 S-adenosyl-L-methionine-depend... Lus10039875 15.2 0.7954

Lus10026842 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.