Lus10026844 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026844 pacid=23142828 polypeptide=Lus10026844 locus=Lus10026844.g ID=Lus10026844.BGIv1.0 annot-version=v1.0
ATGTGCACAAGGAGCTGGTTGCAAAATGAGTTGCTTCAAGATGCAGCTGTTGCGGAAGGTTGCTTCTCTTCTCCACTAATTGAAGACGATCTTATCCAGA
CTGAAGATGAAATTGGAGAAGTTCGGAGCTCCGAGCAACTCCGAAATCCGATGATGGGCGGGGATGGTATCGAATTTAAACCCGATGGCTGTCATCGGGC
GGGGAATCCCCGAATCCGGCACTTCAACGGGTGGGTACCGGATGCATATAAATCCGGCCCCGATCCGCCCGAATGCCAAGCCTAA
AA sequence
>Lus10026844 pacid=23142828 polypeptide=Lus10026844 locus=Lus10026844.g ID=Lus10026844.BGIv1.0 annot-version=v1.0
MCTRSWLQNELLQDAAVAEGCFSSPLIEDDLIQTEDEIGEVRSSEQLRNPMMGGDGIEFKPDGCHRAGNPRIRHFNGWVPDAYKSGPDPPECQA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026844 0 1
AT1G26480 GF14IOTA, GRF12 general regulatory factor 12 (... Lus10036896 2.4 1.0000
Lus10027530 8.4 1.0000
AT1G35720 ATOXY5, ANNAT1 annexin 1 (.1) Lus10036470 8.8 1.0000
AT1G69530 ATHEXPALPHA1.2,... EXPANSIN 1, expansin A1 (.1.2.... Lus10003438 8.8 1.0000
Lus10006296 10.0 1.0000
AT5G49900 Beta-glucosidase, GBA2 type fa... Lus10023340 11.4 1.0000
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10029930 12.0 1.0000
Lus10026042 13.0 1.0000
AT2G06040 unknown protein Lus10017169 14.3 0.9078
Lus10012669 15.9 1.0000

Lus10026844 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.