Lus10026845 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G36930 141 / 2e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
AT1G72920 125 / 2e-34 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
AT5G17680 130 / 5e-34 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G72930 120 / 1e-33 TIR toll/interleukin-1 receptor-like (.1.2)
AT1G72910 125 / 2e-33 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G72950 124 / 5e-33 Disease resistance protein (TIR-NBS class) (.1)
AT1G72940 122 / 3e-32 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G72900 119 / 5e-31 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
AT1G72890 119 / 1e-30 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
AT5G18360 117 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041606 404 / 6e-143 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10027920 298 / 6e-101 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10012063 260 / 7e-87 AT5G36930 124 / 5e-34 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10041605 182 / 2e-57 AT1G72940 93 / 3e-22 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1)
Lus10006929 150 / 6e-44 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Lus10004482 150 / 1e-43 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10029921 152 / 2e-43 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10029919 145 / 2e-42 AT5G36930 105 / 5e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10006928 152 / 4e-42 AT5G36930 165 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G001314 154 / 1e-45 AT5G36930 183 / 1e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G019710 157 / 3e-44 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G019053 160 / 4e-44 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.T002568 154 / 3e-43 AT5G36930 439 / 2e-142 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G096849 146 / 3e-43 AT5G36930 167 / 4e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.017G105501 145 / 5e-43 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G016425 155 / 1e-42 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.013G098100 144 / 1e-42 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G017082 155 / 2e-42 AT5G36930 638 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G003285 154 / 4e-42 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0173 STIR PF01582 TIR TIR domain
Representative CDS sequence
>Lus10026845 pacid=23142936 polypeptide=Lus10026845 locus=Lus10026845.g ID=Lus10026845.BGIv1.0 annot-version=v1.0
ATGGCTTTCAGGTCAGATCCGCCGTTCGCCGCCGCACTAATGCTACTTCTCCTTTTACTTTTCAATTTCATAACCCTACCGGCCAACGCCAAAGCCCATT
CCTTCGGACCAAACAACCGCCGCCGTCACCATCACCCAGCCGCCGCCAAAATCCGACATTTCCCCGTTCCGCCGCCTCCTCCAGCGACGCCGTGGCGTCA
CCACGTGTTCCTAAATTTCCGGGGGTTAGAAATCCGCCACACTTTCAGCGACCATCTCTACTATGCTCTGGTACGGAGAGGAGTGAAGGCCTTTCGCGAC
GACCATGACCTCCCCCGCGGAGAAAACATCACGGAGGCAATCCCACGCGCCATTGAGGAGTCCAGGATGTCGATTGTTGTTCTGTCGAGGGGGTACGCCT
CCTCGGAGTGGTGCTTGGACGAGCTTGTGAAGATTATGGAGGCCGCCAAGGACAAGCGTGCACACCACCAGACTTTCCCCGTTTTCTACAAAGTATCCCC
CGACGAAGTCTCCGACCAGTCATCCGGCTGCTACAAGGAAGACTTCGATCTGCACAAGAGAAAGTTCAGCTACGAAAGAGTGGACAATTGGCGCCACGCG
CTTACTTCCATTGCCGATGTTTCCGGCTGGGAAATCGCTCCTAATGGCCACAGATCGGAAGCAGAAATGGTTGAGACTATAGCCAATAGCATAGTATTGA
AGGTCCACCAGCTTGCTCGGTTCAAATCCGAATCCGAGTCGAATCAGAGTGAACGGCCGGCGTTTGTTCCTGCTTTCCGAGCGCCGGAGGGAGCATTAGA
TGATGATGATGAGCAACCTTCTTCATCCTCTCTGCTGATGGTAGGGTTAGGTTGA
AA sequence
>Lus10026845 pacid=23142936 polypeptide=Lus10026845 locus=Lus10026845.g ID=Lus10026845.BGIv1.0 annot-version=v1.0
MAFRSDPPFAAALMLLLLLLFNFITLPANAKAHSFGPNNRRRHHHPAAAKIRHFPVPPPPPATPWRHHVFLNFRGLEIRHTFSDHLYYALVRRGVKAFRD
DHDLPRGENITEAIPRAIEESRMSIVVLSRGYASSEWCLDELVKIMEAAKDKRAHHQTFPVFYKVSPDEVSDQSSGCYKEDFDLHKRKFSYERVDNWRHA
LTSIADVSGWEIAPNGHRSEAEMVETIANSIVLKVHQLARFKSESESNQSERPAFVPAFRAPEGALDDDDEQPSSSSLLMVGLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G36930 Disease resistance protein (TI... Lus10026845 0 1
Lus10032968 8.5 0.8822
AT1G08650 ATPPCK1, PPCK1 phosphoenolpyruvate carboxylas... Lus10042560 10.3 0.7208
Lus10026821 11.3 0.6934
AT1G68360 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10029204 11.6 0.8284
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10003481 12.2 0.8819
AT1G24140 Matrixin family protein (.1) Lus10008449 13.0 0.7592
AT3G03550 RING/U-box superfamily protein... Lus10009264 14.3 0.7269
Lus10006296 14.8 0.8812
AT5G40690 unknown protein Lus10025381 15.0 0.7879
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014217 17.1 0.8812

Lus10026845 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.