Lus10026848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10110 218 / 1e-73 MEE67 maternal effect embryo arrest 67, Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
AT1G18320 206 / 3e-69 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
AT5G55510 56 / 9e-10 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
AT4G26670 55 / 1e-09 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
AT2G37410 42 / 5e-05 ATTIM17-2 TRANSLOCASE OF THE INNER MEMBRANE 17, translocase inner membrane subunit 17-2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020223 263 / 2e-91 AT3G10110 229 / 8e-78 maternal effect embryo arrest 67, Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Lus10043170 57 / 3e-10 AT4G26670 220 / 5e-73 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Lus10032577 57 / 3e-10 AT4G26670 221 / 1e-73 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G076400 223 / 2e-75 AT3G10110 194 / 1e-63 maternal effect embryo arrest 67, Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Potri.001G281200 223 / 3e-75 AT3G10110 205 / 4e-68 maternal effect embryo arrest 67, Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Potri.011G088500 56 / 5e-10 AT5G55510 252 / 1e-85 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Potri.001G360300 56 / 1e-09 AT5G55510 254 / 2e-86 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Potri.008G176500 40 / 0.0002 AT2G37410 228 / 1e-75 TRANSLOCASE OF THE INNER MEMBRANE 17, translocase inner membrane subunit 17-2 (.1.2)
Potri.018G087900 39 / 0.001 AT2G37410 227 / 3e-75 TRANSLOCASE OF THE INNER MEMBRANE 17, translocase inner membrane subunit 17-2 (.1.2)
Potri.006G164980 39 / 0.001 AT2G37410 234 / 3e-78 TRANSLOCASE OF THE INNER MEMBRANE 17, translocase inner membrane subunit 17-2 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10026848 pacid=23142928 polypeptide=Lus10026848 locus=Lus10026848.g ID=Lus10026848.BGIv1.0 annot-version=v1.0
ATGGCTGAAAGAGGTGAATCGAACAACAATAGCGGATCTCAAAGCTCAGAAACGAAGATCGAGCCGTTCAGGATGCCGTCGGTGGAGGAGATAAGAGCGC
AGGAAGTGTGGAACAACTGCGCGATACGGAGCGCCTTCAGCGGCGTCATCGGCGGAGGGCTGGGAATCTTCATGGGGTTCCTCCTGGGAGCGCTGGACAA
TCCGTTGATGCACGATCCGGACATGAGCGCCAAACAGCAAATCGTGTTCACTGCGAAGCAGATGGGGCGCAGGAGTTGGAGTAACTGCAAGGCCTTCGCG
GTGATGGGGCTTGTGTTCTCCGCCGCCGAGTGCGTCGTGGAGAAGGCCCGTGCCAAACACGATGTCACTAATTCGGCGATCGCCGGGTGCGTCACCGGCG
GCGCCATGTCTGCAAAAGCTGGGCCGAAAGCGGCTTGTGTTGGCTGTGTGGGATTCTCTGCGTTCTCAGTATTGATCGAGAAGTTCTTAGATAGGCATAC
TTGA
AA sequence
>Lus10026848 pacid=23142928 polypeptide=Lus10026848 locus=Lus10026848.g ID=Lus10026848.BGIv1.0 annot-version=v1.0
MAERGESNNNSGSQSSETKIEPFRMPSVEEIRAQEVWNNCAIRSAFSGVIGGGLGIFMGFLLGALDNPLMHDPDMSAKQQIVFTAKQMGRRSWSNCKAFA
VMGLVFSAAECVVEKARAKHDVTNSAIAGCVTGGAMSAKAGPKAACVGCVGFSAFSVLIEKFLDRHT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10110 MEE67 maternal effect embryo arrest ... Lus10026848 0 1
AT4G36130 Ribosomal protein L2 family (.... Lus10025966 9.6 0.8269
AT1G03530 ATNAF1 nuclear assembly factor 1 (.1) Lus10024956 10.4 0.8358
AT3G49910 Translation protein SH3-like f... Lus10019283 13.0 0.8485
AT1G65030 Transducin/WD40 repeat-like su... Lus10025803 13.7 0.8094
AT3G49080 Ribosomal protein S5 domain 2-... Lus10014970 20.5 0.8183
AT4G35490 MRPL11 mitochondrial ribosomal protei... Lus10035432 26.2 0.8245
AT4G28210 EMB1923 embryo defective 1923 (.1) Lus10033723 31.5 0.8179
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 33.8 0.8146
AT4G32430 Pentatricopeptide repeat (PPR)... Lus10017032 41.3 0.8048
AT2G31240 Tetratricopeptide repeat (TPR)... Lus10033883 45.1 0.8006

Lus10026848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.