Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16950 77 / 7e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021093 [exp] 158 / 5e-52 AT5G16950 106 / 2e-31 unknown protein Lus10017219 [exp] 103 / 3e-30 ND 40 / 5e-10
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G082000 [exp] 127 / 1e-39 AT5G16950 91 / 2e-25 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026852 pacid=23142877 polypeptide=Lus10026852 locus=Lus10026852.g ID=Lus10026852.BGIv1.0 annot-version=v1.0 ATGGGATCTGAAGAGCATAAGGATCCATTGAAAGGGGTGGATTGGAAAGCAATAGGTACTGAGCTTCAAAAGGACCCAAGTGCTGGCACAAAACAAGTAG TTAAGAAGCGGCTTCCCAAAAGGATTAGGCAGATTCCTGAAAGCTATTTCCTTCCACGAATGTCCTGGCCCTCTGCCATCGGCTTCTATGGTGCTTGTAT AGCTGGTGGGATTGGGGCTGGCATGCTGGTGGAGATGTGGATTGACAAGAAAGTCAAAGATGATGGCGGCGTTATATGGGAGTTTGATAAGTAA
AA sequence Show only first row Show all	>Lus10026852 pacid=23142877 polypeptide=Lus10026852 locus=Lus10026852.g ID=Lus10026852.BGIv1.0 annot-version=v1.0 MGSEEHKDPLKGVDWKAIGTELQKDPSAGTKQVVKKRLPKRIRQIPESYFLPRMSWPSAIGFYGACIAGGIGAGMLVEMWIDKKVKDDGGVIWEFDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16950			unknown protein		Lus10026852 [exp]	0	1
AT1G14620		XTR2, EXGT-A2, ...	decoy (.1.2)		Lus10012875 [exp]	1.7	0.8495
AT4G38370			Phosphoglycerate mutase family...		Lus10014434 [exp]	3.9	0.7789
AT5G27430			Signal peptidase subunit (.1)		Lus10001092 [exp]	6.9	0.7376
AT1G50910			unknown protein		Lus10011153 [exp]	7.7	0.7778
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	14.0	0.7710
AT4G29390			Ribosomal protein S30 family p...		Lus10002508 [exp]	16.7	0.7619
AT3G51150			ATP binding microtubule motor ...		Lus10033920 [exp]	17.9	0.7216
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10023599 [exp]	18.3	0.7527
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	20.8	0.7885
AT1G71150			unknown protein		Lus10021799 [exp]	26.5	0.6775

Compare expression of checked genes

Lus10026852 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.