Lus10026869 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026869 pacid=23142930 polypeptide=Lus10026869 locus=Lus10026869.g ID=Lus10026869.BGIv1.0 annot-version=v1.0
ATGTTCGGAATAGGAGATGAACGGGGATTGGAATCCATTGGAGCAAACCACAGATCGGCAATCAGAATCAAAAGTTGGGCCTCCTCCGCTATTTCGTCGT
TAGACTCGATAATGCATGCACAATCAGAATCACAGTTGAATGGGCACTCAGCGATTTCACCAAAAGAGGGAGTTCCAAGGACCTTAAGGCGGCAATGGTT
TGTTGTAATAGACTCGGAGAAAAGTCGGGCTTCCGATGACCTGAAGGGGACAGAGGCTTTTGCGCCGACGATAGGGTTCAGCTCAAACCATGAAATCGAT
TCTGTAAGCAACCCTGACTGA
AA sequence
>Lus10026869 pacid=23142930 polypeptide=Lus10026869 locus=Lus10026869.g ID=Lus10026869.BGIv1.0 annot-version=v1.0
MFGIGDERGLESIGANHRSAIRIKSWASSAISSLDSIMHAQSESQLNGHSAISPKEGVPRTLRRQWFVVIDSEKSRASDDLKGTEAFAPTIGFSSNHEID
SVSNPD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026869 0 1
AT5G64700 nodulin MtN21 /EamA-like trans... Lus10020867 1.0 0.8759
Lus10031737 2.0 0.8687
AT4G31050 Biotin/lipoate A/B protein lig... Lus10008181 3.5 0.7847
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10042522 6.7 0.7667
Lus10008920 6.9 0.8131
AT3G01490 Protein kinase superfamily pro... Lus10030868 8.7 0.6491
AT2G15220 Plant basic secretory protein ... Lus10014107 8.9 0.7162
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10010501 11.8 0.7182
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10001033 14.3 0.7636
AT5G43330 c-NAD-MDH2 cytosolic-NAD-dependent malate... Lus10021184 21.9 0.6698

Lus10026869 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.