Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39100 75 / 3e-19 GLP6 germin-like protein 6 (.1) AT5G38940 76 / 6e-19 RmlC-like cupins superfamily protein (.1) AT3G05950 76 / 1e-18 RmlC-like cupins superfamily protein (.1) AT5G39110 75 / 3e-18 RmlC-like cupins superfamily protein (.1) AT5G38910 74 / 6e-18 RmlC-like cupins superfamily protein (.1) AT5G39150 74 / 6e-18 RmlC-like cupins superfamily protein (.1) AT5G39180 74 / 6e-18 RmlC-like cupins superfamily protein (.1) AT5G39120 74 / 8e-18 RmlC-like cupins superfamily protein (.1) AT5G38930 72 / 2e-17 RmlC-like cupins superfamily protein (.1) AT5G39160 71 / 4e-17 RmlC-like cupins superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029571 [exp] 97 / 8e-28 AT3G05950 171 / 1e-54 RmlC-like cupins superfamily protein (.1) Lus10035186 [exp] 99 / 1e-27 AT5G39190 265 / 2e-90 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Lus10035185 [exp] 99 / 2e-27 AT5G39160 265 / 2e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10032015 [exp] 98 / 2e-27 AT5G39160 262 / 3e-89 RmlC-like cupins superfamily protein (.1.2.3) Lus10032016 [exp] 98 / 3e-27 AT5G39160 264 / 3e-90 RmlC-like cupins superfamily protein (.1.2.3) Lus10026962 [exp] 98 / 3e-27 AT3G05950 251 / 6e-85 RmlC-like cupins superfamily protein (.1) Lus10030048 [exp] 97 / 8e-27 AT3G05950 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Lus10035278 [exp] 97 / 1e-26 AT3G05950 254 / 3e-86 RmlC-like cupins superfamily protein (.1) Lus10032017 [exp] 98 / 2e-26 AT3G05950 252 / 5e-84 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G162932 [exp] 99 / 9e-28 AT3G05950 268 / 1e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163200 [exp] 99 / 9e-28 AT3G05950 266 / 5e-91 RmlC-like cupins superfamily protein (.1) Potri.011G163800 [exp] 97 / 7e-27 AT5G39130 255 / 1e-86 RmlC-like cupins superfamily protein (.1) Potri.011G163216 [exp] 93 / 2e-25 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G163300 [exp] 93 / 2e-25 AT5G39160 257 / 2e-87 RmlC-like cupins superfamily protein (.1.2.3) Potri.001G465100 [exp] 90 / 3e-24 AT5G39160 253 / 8e-86 RmlC-like cupins superfamily protein (.1.2.3) Potri.011G162200 [exp] 89 / 6e-24 AT5G39190 246 / 4e-83 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.001G464100 [exp] 87 / 5e-23 AT5G39190 231 / 3e-77 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.001G464000 [exp] 86 / 1e-22 AT5G39190 231 / 4e-77 GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) Potri.013G052000 [exp] 85 / 4e-22 AT5G39110 282 / 5e-97 RmlC-like cupins superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF00190 [flax] [poplar] Cupin_1 Cupin
Representative CDS sequence Show only first row Show all	>Lus10026873 pacid=23142902 polypeptide=Lus10026873 locus=Lus10026873.g ID=Lus10026873.BGIv1.0 annot-version=v1.0 ATGGTTCGCGTGGACTATGCTCCTTGGGGTATCAATCCTTCTCACACTCATCCACGAGCGATTGAGATTTTGACGGTCATTGAAGGCACTCTAAAAGTTG GATTCGTCACATCAAACCCAGAGAACCGCCTCATTTCCAAAATCCTTCAAAAGGAATGTGTTTGTGTTTCCATATGGGTTGATCCACTTCTAGCGCAGTA TTAG
AA sequence Show only first row Show all	>Lus10026873 pacid=23142902 polypeptide=Lus10026873 locus=Lus10026873.g ID=Lus10026873.BGIv1.0 annot-version=v1.0 MVRVDYAPWGINPSHTHPRAIEILTVIEGTLKVGFVTSNPENRLISKILQKECVCVSIWVDPLLAQY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G39100		GLP6	germin-like protein 6 (.1)		Lus10026873 [exp]	0	1

Compare expression of checked genes

Lus10026873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.