Lus10026877 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G24720 121 / 4e-32 ATGLR2.2 glutamate receptor 2.2 (.1)
AT2G29100 117 / 1e-30 ATGLR2.9 GLUTAMATE RECEPTOR 2.9, glutamate receptor 2.9 (.1)
AT2G29120 114 / 6e-30 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
AT4G31710 108 / 1e-27 ATGLR2.4 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.4, glutamate receptor 2.4 (.1)
AT2G29110 104 / 3e-26 ATGLR2.8 glutamate receptor 2.8 (.1)
AT5G27100 103 / 5e-26 ATGLR2.1 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.1, glutamate receptor 2.1 (.1)
AT2G24710 102 / 1e-25 ATGLR2.3 glutamate receptor 2.3 (.1)
AT5G11180 99 / 2e-24 ATGLR2.6 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.6, glutamate receptor 2.6 (.1)
AT5G11210 71 / 2e-14 ATGLR2.5 ARABIDOPSIS THALIANA GLU, glutamate receptor 2.5 (.1)
AT3G07520 69 / 9e-14 ATGLR1.4 glutamate receptor 1.4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003436 252 / 8e-79 AT2G29120 867 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10020109 224 / 1e-68 AT2G29120 822 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10026235 164 / 5e-47 AT2G29120 912 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10026914 140 / 1e-43 AT2G29100 65 / 1e-13 GLUTAMATE RECEPTOR 2.9, glutamate receptor 2.9 (.1)
Lus10026913 92 / 1e-21 AT2G29120 790 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10016031 56 / 2e-09 AT1G42540 1123 / 0.0 glutamate receptor 3.3 (.1)
Lus10039672 54 / 2e-08 AT2G32400 969 / 0.0 GLUTAMATE RECEPTOR 3.7, glutamate receptor 5 (.1)
Lus10027170 53 / 2e-08 AT2G32400 970 / 0.0 GLUTAMATE RECEPTOR 3.7, glutamate receptor 5 (.1)
Lus10012245 52 / 6e-08 AT1G42540 1258 / 0.0 glutamate receptor 3.3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G012100 134 / 7e-37 AT2G29120 934 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.006G268450 127 / 1e-36 AT5G27100 243 / 8e-75 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.1, glutamate receptor 2.1 (.1)
Potri.018G011800 133 / 2e-36 AT2G29110 805 / 0.0 glutamate receptor 2.8 (.1)
Potri.018G013200 133 / 2e-36 AT2G29120 882 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.018G012000 132 / 4e-36 AT2G29110 821 / 0.0 glutamate receptor 2.8 (.1)
Potri.018G012300 130 / 2e-35 AT2G24720 822 / 0.0 glutamate receptor 2.2 (.1)
Potri.006G268200 128 / 2e-34 AT2G29120 841 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.006G268700 127 / 2e-34 AT2G29120 855 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.006G268900 125 / 8e-34 AT2G29110 882 / 0.0 glutamate receptor 2.8 (.1)
Potri.018G012600 125 / 8e-34 AT2G29120 946 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0144 Periplas_BP PF01094 ANF_receptor Receptor family ligand binding region
Representative CDS sequence
>Lus10026877 pacid=23142900 polypeptide=Lus10026877 locus=Lus10026877.g ID=Lus10026877.BGIv1.0 annot-version=v1.0
ATGGAAAGTACTAACATTTTACTTTTGTTCAGCATGATGAGCTTGTTCGCTGCAGTTCATTCCTTTACGAAACATAATATTCGCGAGGCGCCGACGGCGG
GGCAGAGTAACGCGACGGTTGCAGTGAAGATCGGAGTGATTCTTGACTTGAACGGCAGCGACGACAACCTCGTTGGCCGAGTTGGGCTTAGCTGTATTCA
AATGGCAGTTTCCGATTTCTACGCAGCTCGTCCAAACTACACCACCCGCCTCGACATCCACGCCAGGGATTCTCCCGGAGACGACGTCGTTCAGGCTGCT
TCGTCAGTGGAAGCAATATTGGGCCCCGAAACGTCAATGCAAGCCCATTTCATCGTAGCTCTTGGAGAAAAGGTTCACGTTCCAATCATCTCATTCTCGG
CATCAAGCCCCACCGTCGATTCTTCCAACCAAGACCCTTACTTCTTCCGCGCTAATCCAACGGACTCCACTCAAGCACATGTCATAAGCGGCATAGTGAA
AGCTCATGACAATGCAAACTAG
AA sequence
>Lus10026877 pacid=23142900 polypeptide=Lus10026877 locus=Lus10026877.g ID=Lus10026877.BGIv1.0 annot-version=v1.0
MESTNILLLFSMMSLFAAVHSFTKHNIREAPTAGQSNATVAVKIGVILDLNGSDDNLVGRVGLSCIQMAVSDFYAARPNYTTRLDIHARDSPGDDVVQAA
SSVEAILGPETSMQAHFIVALGEKVHVPIISFSASSPTVDSSNQDPYFFRANPTDSTQAHVISGIVKAHDNAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 0 1
AT4G29280 LCR22 low-molecular-weight cysteine-... Lus10015983 1.4 1.0000
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 2.4 1.0000
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 3.0 1.0000
AT5G18460 Protein of Unknown Function (D... Lus10006860 3.2 1.0000
Lus10009372 3.5 1.0000
Lus10000400 3.5 1.0000
AT3G45600 TET3 tetraspanin3 (.1) Lus10023218 5.3 0.9926
AT5G19580 glyoxal oxidase-related protei... Lus10043230 6.0 0.9620
AT5G63810 BGAL10 beta-galactosidase 10 (.1) Lus10023977 6.3 0.9889
AT2G27930 PLATZ transcription factor fam... Lus10036044 7.1 0.9397

Lus10026877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.