Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31850 147 / 3e-42 PGR3 proton gradient regulation 3 (.1) AT5G65560 87 / 5e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G51965 86 / 8e-21 ABO5 ABA Overly-Sensitive 5 (.1) AT1G55630 85 / 2e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74900 83 / 1e-19 OTP43 organelle transcript processing defect 43, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G46100 79 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62910 79 / 4e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 78 / 6e-18 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G06710 77 / 8e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G05670 77 / 9e-18 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003424 [exp] 220 / 6e-68 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1) Lus10013894 [exp] 89 / 8e-22 AT5G02860 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002107 [exp] 88 / 2e-21 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10042016 [exp] 84 / 4e-20 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10023863 [exp] 79 / 2e-18 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10018019 [exp] 79 / 3e-18 AT2G32630 590 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10013972 [exp] 78 / 6e-18 AT5G46100 520 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10026558 [exp] 78 / 7e-18 AT5G65560 881 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025533 [exp] 77 / 2e-17 AT1G06710 980 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G264800 [exp] 166 / 9e-49 AT4G31850 1428 / 0.0 proton gradient regulation 3 (.1) Potri.007G123600 [exp] 84 / 5e-20 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.014G117600 [exp] 83 / 9e-20 AT1G12700 330 / 1e-105 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.002G109500 [exp] 82 / 2e-19 AT1G09900 855 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.013G105000 [exp] 81 / 4e-19 AT1G51965 855 / 0.0 ABA Overly-Sensitive 5 (.1) Potri.003G008900 [exp] 81 / 8e-19 AT2G32630 612 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.005G047400 [exp] 81 / 8e-19 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G166001 [exp] 80 / 1e-18 AT4G26680 697 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.015G144100 [exp] 79 / 3e-18 AT1G55630 608 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G046000 [exp] 77 / 1e-17 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10026888 pacid=23142880 polypeptide=Lus10026888 locus=Lus10026888.g ID=Lus10026888.BGIv1.0 annot-version=v1.0 ATGATTGATGGTCTGGGAAGATGTGGCAAGATAGAAGAAGCTCTCGTAATGTTTGAAGAAATTAGAGATAGAGGTCTGACCCCTGATCTTTACACATACA ACGCCTTAATTCTCTATCTTGGAATTGGCGGAATGGTAGAAGAAGCAAAAGAGATGTATGAAGAGCTTGAAAATGTGGGTCTCGAGCCTAACGTATACAC TTACAATGCGCTGATTCGGGGTTACAGTATGTCTGGAAGTTCAGATCTTGCTTATGCTGTCTACGAGAAGATGATGGTCGGAGGCTGCAGTCCCAACGAT GGAACGTTTGCTCAGCTCCCGAATCCTTCATGA
AA sequence Show only first row Show all	>Lus10026888 pacid=23142880 polypeptide=Lus10026888 locus=Lus10026888.g ID=Lus10026888.BGIv1.0 annot-version=v1.0 MIDGLGRCGKIEEALVMFEEIRDRGLTPDLYTYNALILYLGIGGMVEEAKEMYEELENVGLEPNVYTYNALIRGYSMSGSSDLAYAVYEKMMVGGCSPND GTFAQLPNPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31850		PGR3	proton gradient regulation 3 (...		Lus10026888 [exp]	0	1
AT4G21445			unknown protein		Lus10002594 [exp]	4.9	0.9436
AT4G09040			RNA-binding (RRM/RBD/RNP motif...		Lus10036468 [exp]	7.1	0.9404
AT5G55220			trigger factor type chaperone ...		Lus10010250 [exp]	8.7	0.9332
AT3G12930			Lojap-related protein (.1)		Lus10027381 [exp]	10.5	0.8955
AT1G30610		EMB88, EMB2279	EMBRYO DEFECTIVE 88, EMBRYO DE...		Lus10023384 [exp]	14.7	0.8956
AT5G40950		RPL27	ribosomal protein large subuni...		Lus10041553 [exp]	18.5	0.9257
AT2G33450			Ribosomal L28 family (.1)		Lus10023747 [exp]	19.6	0.9255
AT5G66470			RNA binding;GTP binding (.1)		Lus10014289 [exp]	21.8	0.9238
AT3G47650			DnaJ/Hsp40 cysteine-rich domai...		Lus10030091 [exp]	22.6	0.9234
AT4G38160		PDE191	pigment defective 191, Mitocho...		Lus10026571 [exp]	25.3	0.9204

Compare expression of checked genes

Lus10026888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.